UbcH5c/UBE2D3 Antibody - BSA Free

Western Blot: UbcH5c/UBE2D3 Antibody [NBP2-82368] - Host: Rabbit. Target Name: UBE2D3. Sample Tissue: Human 293T Whole Cell lysates. Antibody Dilution: 1ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

UbcH5c/UBE2D3 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human UBE2D3. Peptide sequence: TISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: UBE2D3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 147 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for UbcH5c/UBE2D3 Antibody - BSA Free

• E2(17)KB 3
• E2(17)KB3
• EC 6.3.2.19
• MGC43926
• MGC5416
• UBC4/5
• UBC5C
• UbcH5c
• UBE2D3
• Ubiquitin carrier protein D3
• ubiquitin-conjugating enzyme E2 D3
• Ubiquitin-conjugating enzyme E2(17)KB 3
• Ubiquitin-conjugating enzyme E2-17 kDa 3
• ubiquitin-conjugating enzyme E2D 3 (homologous to yeast UBC4/5)
• ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast)
• Ubiquitin-protein ligase D3

Background

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme functions in the ubiquitination of the tumor-suppressor protein p53, which is induced by an E3 ubiquitin-protein ligase. Multiple spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: UBE2D3