UbcH5a/UBE2D1 Antibody - BSA Free

Western Blot: UbcH5a/UBE2D1 Antibody [NBP1-55033] - Jurkat cell lysate, concentration 1.25ug/ml.

Western Blot: UbcH5a/UBE2D1 Antibody [NBP1-55033] - Lanes: 1 : 40 ng HIS-UBE2D1 protein2: 40 ng HIS-UBE2D2 protein3: 40 ng HIS-UBE2D3 protein4: 40 ng HIS-UBE2D4 protein5: 40 ng HIS-UBE2E1 protein6: 40 ng HIS-UBE2E2 protein7: 40 ng HIS-UBE2E3 protein8: 40 ng HIS-UBE2K protein9: 40 ng HIS-UBE2L3 protein10: 40 ng HIS-UBE2N protein11 : 40 ng HIS-UBE2V1 protein12: 40 ng HIS-UBE2V2 protein. Primary Antibody Dilution: 1 : 500 Secondary Antibody: Anti-rabbit-HRP Secondary Antibody Dilution: 1 : 50,000.

• Reactivity: Hu, Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 1 mg/ml

UbcH5a/UBE2D1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to UBE2D1(ubiquitin-conjugating enzyme E2D 1 (UBC4/5 homolog, yeast)) The peptide sequence was selected from the middle region of UBE2D1. Peptide sequence SQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHARE. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: UBE2D1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 16 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for UbcH5a/UBE2D1 Antibody - BSA Free

• E2(17)KB1
• Stimulator of Fe transportUBC4/5 homolog
• UBC4/5
• UBC5A
• UbcH5
• UbcH5a
• UBCH5AEC 6.3.2.19
• UBCH5SFT
• UBE2D1
• Ubiquitin carrier protein D1
• ubiquitin-conjugating enzyme E2 D1
• Ubiquitin-conjugating enzyme E2(17)KB 1
• Ubiquitin-conjugating enzyme E2-17 kDa 1
• ubiquitin-conjugating enzyme E2D 1 (UBC4/5 homolog, yeast)
• Ubiquitin-protein ligase D1

Background

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE2D1 is a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is closely related to a stimulator of iron transport (SFT), and is up-regulated in hereditary hemochromatosis. It also functions in the ubiquitination of the tumor-suppressor protein p53 and the hypoxia-inducible transcription factor HIF1alpha by interacting with the E1 ubiquitin-activating enzyme and the E3 ubiquitin-protein ligases.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: UBE2D1
• Uniprot:
  • P51668(Human)