UBAP2L Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: UBAP2L Antibody [NBP1-83034] - Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear speckles & cytosol.
Immunohistochemistry-Paraffin: UBAP2L Antibody [NBP1-83034] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

UBAP2L Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PINPATAAAYPPAPFMHILTPHQQPHSQILHHHLQQDGQLPYLQMILCCQRQQEEQTGSGQRSQTSSIPQK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UBAP2L
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
UBAP2L Protein (NBP1-83034PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for UBAP2L Antibody

  • FLJ42300
  • KIAA0144NICE-4
  • NICE4
  • Protein NICE-4
  • ubiquitin associated protein 2-like
  • ubiquitin-associated protein 2-like

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00008878-M01
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
AF5458
Species: Hu
Applications: WB, ICC
NBP2-01833
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-87382
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-85671
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
NB600-1160
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP2-23450
Species: Mu
NBP1-71703
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-49394
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-87003
Species: Hu, Rt
Applications: WB, IP, PLA
NBP1-82623
Species: Hu
Applications: IHC, IHC-P
NBP1-87986
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-83254
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16543
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-02627
Species: Hu, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for UBAP2L Antibody (NBP1-83034) (0)

There are no publications for UBAP2L Antibody (NBP1-83034).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UBAP2L Antibody (NBP1-83034) (0)

There are no reviews for UBAP2L Antibody (NBP1-83034). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for UBAP2L Antibody (NBP1-83034) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UBAP2L Products

Bioinformatics Tool for UBAP2L Antibody (NBP1-83034)

Discover related pathways, diseases and genes to UBAP2L Antibody (NBP1-83034). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UBAP2L Antibody (NBP1-83034)

Discover more about diseases related to UBAP2L Antibody (NBP1-83034).
 

Pathways for UBAP2L Antibody (NBP1-83034)

View related products by pathway.

Blogs on UBAP2L

There are no specific blogs for UBAP2L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UBAP2L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UBAP2L