UBAC1 Antibody - BSA Free

Western Blot: UBAC1 Antibody [NBP2-88531] - Host: Rabbit. Target Name: UBAC1. Sample Tissue: Human 293T Whole Cell lysates. Antibody Dilution: 1ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

UBAC1 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human UBAC1. Peptide sequence: SPLFQAILDNPVVQLGLTNPKTLLAFEDMLENPLNSTQWMNDPETGPVML The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: UBAC1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for UBAC1 Antibody - BSA Free

• E3 ubiquitin-protein ligase subunit KPC2
• GBDR1UBA domain-containing protein 1
• Glialblastoma cell differentiation-related protein 1
• Kip1 ubiquitination-promoting complex protein 2
• KPC2
• putative glialblastoma cell differentiation-related protein
• RP11-432J22.3
• UBA domain containing 1
• UBADC1
• ubiquitin associated domain containing 1
• ubiquitin-associated domain-containing protein 1

Background

Non-catalytic subunit of the KPC complex that acts as E3 ubiquitin-protein ligase. Required for poly-ubiquitination and proteasome-mediated degradation of CDKN1B during G1 phase of the cell cycle

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: UBAC1