RNF123 Antibody (3F8) - Azide and BSA Free

Western Blot: RNF123 Antibody (3F8) [H00063891-M01] - RNF123 monoclonal antibody (M01), clone 3F8 Analysis of RNF123 expression in HeLa.

ELISA: RNF123 Antibody (3F8) [H00063891-M01] - Detection limit for recombinant GST tagged RNF123 is 0.1 ng/ml as a capture antibody.

• Reactivity: Hu, Rb
• Applications: WB, ELISA
• Clone: 3F8
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

RNF123 Antibody (3F8) - Azide and BSA Free Summary

• Immunogen: RNF123 (NP_071347, 1216 a.a. ~ 1314 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ADYISADELAQVEQMLAHLTSASAQAAAASLPTSEEDLCPICYAHPISAVFQPCGHKSCKACINQHLMNNKDCFFCKTTIVSVEDWEKGANTSTTSSAA
• Specificity: RNF123 - ring finger protein 123
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: RNF123
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RNF123 Antibody (3F8) - Azide and BSA Free

• DKFZp686C2222
• E3 ubiquitin-protein ligase RNF123
• EC 6.3.2.-
• FLJ12565
• Kip1 ubiquitination-promoting complex protein 1
• KPC1
• ring finger protein 123MGC163504
• ubiquitin ligase

Background

The protein encoded by this gene contains a RING finger, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RNF123 Antibody (H00063891-M01)(1)

Publication using H00063891-M01

• Baugh JM, Viktorova EG, Pilipenko EV. Proteasomes Can Degrade a Significant Proportion of Cellular Proteins Independent of Ubiquitination. Journal of Molecular Biology , doi:10.1016/j.jmb.2008.12.081. 2009-01-01 [PMID: 19162040]

Bioinformatics

• Gene Symbol: RNF123
• Entrez:
  • 63891(Human)
• Uniprot:
  • NP_071347(Human)