We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

UBA3 Recombinant Protein Antigen

Images

 
There are currently no images for UBA3 Recombinant Protein Antigen (NBP2-48628PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

UBA3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human UBA3.

Source: E. coli

Amino Acid Sequence: YPPQVNFPMCTIASMPRLPEHCIEYVRMLQWPKEQPFGEGVPLDGDDPEHIQWIFQKSLERASQYNIRGVTYRLTQGVVKRIIPAVASTNAVIAAVCA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
UBA3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-48628.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for UBA3 Recombinant Protein Antigen

  • DKFZp566J164
  • EC 6.3.2
  • EC 6.3.2.-
  • hUBA3
  • MGC22384
  • NEDD8-activating enzyme E1 catalytic subunit
  • NEDD8-activating enzyme E1C
  • Nedd8-activating enzyme hUba3
  • UBA3
  • UBA3, ubiquitin-activating enzyme E1 homolog
  • UBE1C
  • Ubiquitin-activating enzyme 3
  • ubiquitin-activating enzyme E1C (homologous to yeast UBA3)
  • Ubiquitin-activating enzyme E1C
  • ubiquitin-like modifier activating enzyme 3
  • Ubiquitin-like modifier-activating enzyme 3
  • yeast)

Background

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E1 ubiquitin-activating enzyme family. The encoded enzyme associates with AppBp1, an amyloid beta precursor protein binding protein, to form a heterodimer, and then the enzyme complex activates NEDD8, a ubiquitin-like protein, which regulates cell division, signaling and embryogenesis. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

UL-812
Species: Hu, Mu, Rt
Applications: EnzAct
NBP1-92162
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
E2-656
Species: Hu, Mu, Rt
Applications: EnzAct
NBP3-16092
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
AF9024
Species: Mu, Rt
Applications: IHC, WB
NBP2-82489
Species: Hu
Applications: ELISA
NBP2-13961
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
H00143384-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
E-305
Species: Hu
Applications: EnzAct
NBP2-03688
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-31302
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
NBP1-89150
Species: Hu
Applications: IHC,  IHC-P, WB
H00011026-M01
Species: Hu
Applications: ELISA, WB
NBP2-13075
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, WB
NB100-74510
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
255-SC
Species: Hu
Applications: BA
NBP1-89917
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB

Publications for UBA3 Recombinant Protein Antigen (NBP2-48628PEP) (0)

There are no publications for UBA3 Recombinant Protein Antigen (NBP2-48628PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UBA3 Recombinant Protein Antigen (NBP2-48628PEP) (0)

There are no reviews for UBA3 Recombinant Protein Antigen (NBP2-48628PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for UBA3 Recombinant Protein Antigen (NBP2-48628PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional UBA3 Products

Research Areas for UBA3 Recombinant Protein Antigen (NBP2-48628PEP)

Find related products by research area.

Blogs on UBA3

There are no specific blogs for UBA3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our UBA3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol UBA3