UAP56 Antibody (4A0Q2)

Western Blot: UAP56 Antibody (4A0Q2) [NBP3-16873] - Western blot analysis of extracts of various cell lines, using UAP56 Rabbit mAb (NBP3-16873) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Western Blot: UAP56 Antibody (4A0Q2) [NBP3-16873] - Western blot analysis of extracts of Rat lung, using UAP56 Rabbit mAb (NBP3-16873) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.

Immunohistochemistry: UAP56 Antibody (4A0Q2) [NBP3-16873] - Immunohistochemistry analysis of UAP56 in paraffin-embedded mouse brain tissue using UAP56 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: UAP56 Antibody (4A0Q2) [NBP3-16873] - Immunohistochemistry analysis of UAP56 in paraffin-embedded mouse lung tissue using UAP56 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: UAP56 Antibody (4A0Q2) [NBP3-16873] - Immunohistochemistry analysis of UAP56 in paraffin-embedded mouse liver tissue using UAP56 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: UAP56 Antibody (4A0Q2) [NBP3-16873] - Immunohistochemistry analysis of UAP56 in paraffin-embedded human colon tissue using UAP56 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: UAP56 Antibody (4A0Q2) [NBP3-16873] - Immunohistochemistry analysis of UAP56 in paraffin-embedded rat spleen tissue using UAP56 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: UAP56 Antibody (4A0Q2) [NBP3-16873] - Immunohistochemistry analysis of UAP56 in paraffin-embedded human lung tissue using UAP56 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clone: 4A0Q2
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

UAP56 Antibody (4A0Q2) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 310-428 of human UAP56 (Q13838). QNFPAIAIHRGMPQEERLSRYQQFKDFQRRILVATNLFGRGMDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNISELPDEIDISSYIEQTR
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: DDX39B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for UAP56 Antibody (4A0Q2)

• 56 kDa U2AF65-associated protein
• ATP-dependent RNA helicase p47
• DEAD (Asp-Glu-Ala-Asp) box polypeptide 39B
• DEAD box protein UAP56
• EC 3.6.4.13
• HLA-B associated transcript 1
• HLA-B-associated transcript 1 protein
• spliceosome RNA helicase BAT1
• UAP56D6S81EBAT1nuclear RNA helicase (DEAD family)

Background

UAP56 encodes a member of the DEAD box family of RNA-dependent ATPases that mediate ATP hydrolysis during pre-mRNA splicing. The encoded protein is an essential splicing factor required for association of U2 small nuclear ribonucleoprotein with pre-mRNA, and also plays an important role in mRNA export from the nucleus to the cytoplasm. A cluster of genes, BAT1-BAT5, is localized in the vicinity of the genes for TNF alpha and TNF beta. These genes are all within the human major histocompatibility complex class III region. Mutations in this gene may be associated with rheumatoid arthritis. Alternatively spliced transcript variants encoding the same protein have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DDX39B