UAP1 Antibody

Images

 
Western Blot: UAP1 Antibody [NBP1-89197] - Analysis in human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: UAP1 Antibody [NBP1-89197] - Staining of human cell line A-431 shows localization to nucleoplasm, plasma membrane & cytosol.
Immunohistochemistry-Paraffin: UAP1 Antibody [NBP1-89197] - Staining of human adrenal gland shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: UAP1 Antibody [NBP1-89197] - Staining of human testis shows cytoplasmic and nuclear positivity of cells in seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

UAP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NDLKLTLSKAGQEHLLRFWNELEEAQQVELYAELQAMNFEELNFFFQKAIEGFNQSSHQKNVDARMEPVPREVLGSATRDQDQLQAWESEGLFQISQNKVAVLLLAGGQGTRLGVAYPKGMYDVGLPSRKTLFQIQAERILKLQQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UAP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
UAP1 Protein (NBP1-89197PEP)
Publications
Read Publication using NBP1-89197.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (85%). Reactivity reported in scientific literature (PMID: 23724116)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for UAP1 Antibody

  • AGX
  • AGX1
  • AGX2
  • Antigen X
  • EC 2.7.7
  • EC 2.7.7.23
  • EC 2.7.7.27
  • SPAG2
  • sperm associated antigen 2
  • Sperm-associated antigen 2
  • UDP-N-acetylhexosamine pyrophosphorylase
  • UDP-N-acteylglucosamine pyrophosphorylase 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-48900
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76602
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-32210
Species: Hu
Applications: WB, IHC, IHC-P
AF175
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
AF4600
Species: Mu
Applications: WB, IP
NB100-565
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-83842
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF972
Species: Hu
Applications: WB, Simple Western, IHC
H00023169-R01
Species: Hu
NBP2-38040
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-46781
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF6144
Species: Hu
Applications: WB, Simple Western
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF

Publications for UAP1 Antibody (NBP1-89197)(1)

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
All Species

Reviews for UAP1 Antibody (NBP1-89197) (0)

There are no reviews for UAP1 Antibody (NBP1-89197). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for UAP1 Antibody (NBP1-89197) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UAP1 Products

Bioinformatics Tool for UAP1 Antibody (NBP1-89197)

Discover related pathways, diseases and genes to UAP1 Antibody (NBP1-89197). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on UAP1

There are no specific blogs for UAP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UAP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UAP1