TUSC3 Antibody

Images

 
Immunohistochemistry-Paraffin: TUSC3 Antibody [NBP2-48952] - Staining of human urinary bladder shows strong cytoplasmic and membranous positivity in urothelial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TUSC3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: GQKKKENLLAEKVEQLMEWSSRRSIFRMNGDKFRKFI
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TUSC3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TUSC3 Recombinant Protein Antigen (NBP2-48952PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TUSC3 Antibody

  • D8S1992
  • M33
  • N33MRT7MGC13453
  • oligosaccharyltransferase 3 homolog A
  • OST3A
  • Protein N33
  • Putative prostate cancer tumor suppressor
  • tumor suppressor candidate 3

Background

TUSC3 is a candidate tumor suppressor gene. It is located within a homozygously deleted region of a metastatic prostate cancer. The gene is expressed in most nonlymphoid human tissues including prostate, lung, liver, and colon. Expression was also detected in many epithelial tumor cell lines. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-47524
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-88921
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-96140
Species: Hu, Mu
Applications: ChIP, Flow-IC, Flow, ICC/IF, IP, WB
NBP2-45603
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NBP1-82454
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-86509
Species: Hu
Applications: IHC, IHC-P
NBP2-67381
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
NBP1-80830
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-37463
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
NB100-1240
Species: Hu
Applications: PEP-ELISA, WB
NBP1-47842
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP1-87431
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF2065
Species: Mu
Applications: ICC, IHC, Simple Western, WB
AF3749
Species: Hu
Applications: IHC, WB
NB100-168
Species: Hu, Mu(-)
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-80965
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB

Publications for TUSC3 Antibody (NBP2-48952) (0)

There are no publications for TUSC3 Antibody (NBP2-48952).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TUSC3 Antibody (NBP2-48952) (0)

There are no reviews for TUSC3 Antibody (NBP2-48952). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TUSC3 Antibody (NBP2-48952) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TUSC3 Products

Bioinformatics Tool for TUSC3 Antibody (NBP2-48952)

Discover related pathways, diseases and genes to TUSC3 Antibody (NBP2-48952). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TUSC3 Antibody (NBP2-48952)

Discover more about diseases related to TUSC3 Antibody (NBP2-48952).
 

Pathways for TUSC3 Antibody (NBP2-48952)

View related products by pathway.

PTMs for TUSC3 Antibody (NBP2-48952)

Learn more about PTMs related to TUSC3 Antibody (NBP2-48952).
 

Research Areas for TUSC3 Antibody (NBP2-48952)

Find related products by research area.

Blogs on TUSC3

There are no specific blogs for TUSC3, but you can read our latest blog posts.
Download our IHC Handbook

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TUSC3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TUSC3