We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Tumstatin/COL4A3 Recombinant Protein Antigen

Images

 

Product Details

Summary
Product Discontinued
View other related Tumstatin/COL4A3 Peptides and Proteins

Order Details


    • Catalog Number
      NBP1-85836PEP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Tumstatin/COL4A3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human COL4A3.

Source: E. coli

Amino Acid Sequence: KDGVPGFPGSEGVKGNRGFPGLMGEDGIKGQKGDIGPPGFRGPTEYYDTYQEKGDEGTPGPPGPRGARG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
COL4A3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85836.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Tumstatin/COL4A3 Recombinant Protein Antigen

  • COL4A3
  • collagen alpha-3(IV) chain
  • collagen IV, alpha-3 polypeptide
  • collagen, type IV, alpha 3 (Goodpasture antigen)
  • Goodpasture antigen
  • Tumstatin

Background

COL4A3 (Collagen, type IV, alpha 3) belongs to the type IV collagen family. Type IV collagen is the major structural component of glomerular basement membranes (GBM), forming a 'chicken-wire' meshwork together with laminins, proteoglycans and entactin/nidogen. Type IV collagen is a multimeric protein composed of 3 alpha subunits. These subunits are encoded by 6 different genes, alpha 1 through alpha 6, each of which can form a triple helix structure with 2 other subunits to form type IV collagen. Tumstatin, a cleavage fragment corresponding to the collagen alpha 3(IV) NC1 domain, possesses both anti-angiogenic and anti-tumor cell activity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-43374
Species: Hu
Applications: ELISA
NBP3-41417
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, WB
DVE00
Species: Hu
Applications: ELISA
DNST0
Species: Hu
Applications: ELISA
DTSP10
Species: Hu
Applications: ELISA
NBP2-92506
Species: Hu, Mu, Rt
Applications: ELISA, WB
NB120-6586
Species: Bv, Fe, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, KO, mIF, Simple Western, SR Microscopy, WB
H00001288-P02
Species: Hu
Applications: ELISA, AP, PA, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
DMP900
Species: Hu
Applications: ELISA
MAB2528
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC, IP
NB600-607
Species: Hu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP3-12897
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
DANG20
Species: Hu
Applications: ELISA
NBP1-85836PEP
Species: Hu
Applications: AC

Publications for Tumstatin/COL4A3 Recombinant Protein Antigen (NBP1-85836PEP) (0)

There are no publications for Tumstatin/COL4A3 Recombinant Protein Antigen (NBP1-85836PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Tumstatin/COL4A3 Recombinant Protein Antigen (NBP1-85836PEP) (0)

There are no reviews for Tumstatin/COL4A3 Recombinant Protein Antigen (NBP1-85836PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Tumstatin/COL4A3 Recombinant Protein Antigen (NBP1-85836PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Tumstatin/COL4A3 Products

Array NBP1-85836PEP

Research Areas for Tumstatin/COL4A3 Recombinant Protein Antigen (NBP1-85836PEP)

Find related products by research area.

Blogs on Tumstatin/COL4A3

There are no specific blogs for Tumstatin/COL4A3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Tumstatin/COL4A3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol COL4A3