Tumstatin/COL4A3 Antibody

Product Discontinued

Tumstatin/COL4A3 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KDGVPGFPGSEGVKGNRGFPGLMGEDGIKGQKGDIGPPGFRGPTEYYDTYQEKGDEGTPGPPGPRGARG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: COL4A3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1-4 ug/ml
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: WB reported in scientific literature (PMID: 26331477). ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Mouse and Human reactivity reported in scientific literature (PMID: 26331477).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Tumstatin/COL4A3 Antibody

• COL4A3
• collagen alpha-3(IV) chain
• collagen IV, alpha-3 polypeptide
• collagen, type IV, alpha 3 (Goodpasture antigen)
• Goodpasture antigen
• Tumstatin

Background

COL4A3 (Collagen, type IV, alpha 3) belongs to the type IV collagen family. Type IV collagen is the major structural component of glomerular basement membranes (GBM), forming a 'chicken-wire' meshwork together with laminins, proteoglycans and entactin/nidogen. Type IV collagen is a multimeric protein composed of 3 alpha subunits. These subunits are encoded by 6 different genes, alpha 1 through alpha 6, each of which can form a triple helix structure with 2 other subunits to form type IV collagen. Tumstatin, a cleavage fragment corresponding to the collagen alpha 3(IV) NC1 domain, possesses both anti-angiogenic and anti-tumor cell activity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Tumstatin/COL4A3 Antibody (NBP1-85836)(2)

Publications using NBP1-85836

• Jeruschke S, Jeruschke K, DiStasio A et al. Everolimus Stabilizes Podocyte Microtubules via Enhancing TUBB2B and DCDC2 Expression. PLoS One 2015-01-01 [PMID: 26331477] (WB, Human, Mouse)
• Akhgar A The Exploration of Non-invasive Biomarkers for Lupus Nephritis Thesis 2021-01-01 (IHC-P, Human)

FAQs for Tumstatin/COL4A3 Antibody (NBP1-85836). (Showing 1 - 1 of 1 FAQs).

1. Would you please let me know the western blot condition used here? More precisely, which type of gel do you run to detect Col4A3 -native or denatured gel?
   • For western blot, our lab used the Criterion TGX Precast Gels, 4–20% polyacrylamide (Bio-Rad, Hercules, CA, USA) run under denatured and reducing conditions.

Bioinformatics

• Gene Symbol: COL4A3