Tumstatin/COL4A3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Tumstatin/COL4A3 Antibody [NBP1-85836] - Immunofluorescent staining of human cell line HeLa shows localization to endoplasmic reticulum & vesicles. Antibody staining is shown in ...read more
Immunohistochemistry-Paraffin: Tumstatin/COL4A3 Antibody [NBP1-85836] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Tumstatin/COL4A3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KDGVPGFPGSEGVKGNRGFPGLMGEDGIKGQKGDIGPPGFRGPTEYYDTYQEKGDEGTPGPPGPRGARG
Specificity
Specificity of human, mouse Tumstatin/COL4A3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
COL4A3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Tumstatin/COL4A3 Recombinant Protein Antigen (NBP1-85836PEP)
Publications
Read Publication using
NBP1-85836 in the following applications:

  • WB
    1 publication

Reactivity Notes

Mouse, Human reactivity reported in scientific literature (PMID: 26331477).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Tumstatin/COL4A3 Antibody

  • COL4A3
  • collagen alpha-3(IV) chain
  • collagen IV, alpha-3 polypeptide
  • collagen, type IV, alpha 3 (Goodpasture antigen)
  • Goodpasture antigen
  • Tumstatin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-64634
Species: Hu
NB120-6586
Species: Hu, Mu, Rt, Bv, Ma
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-56903
Species: Hu
Applications: ICC/IF
NB100-724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NB600-607
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-91258
Species: Hu, Mu, Bv, Ca, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-67327
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP

Publications for Tumstatin/COL4A3 Antibody (NBP1-85836)(1)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
Mouse
(1)
All Species

Reviews for Tumstatin/COL4A3 Antibody (NBP1-85836) (0)

There are no reviews for Tumstatin/COL4A3 Antibody (NBP1-85836). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Tumstatin/COL4A3 Antibody (NBP1-85836). (Showing 1 - 1 of 1 FAQ).

  1. Would you please let me know the western blot condition used here? More precisely, which type of gel do you run to detect Col4A3 -native or denatured gel?
    • For western blot, our lab used the Criterion TGX Precast Gels, 4–20% polyacrylamide (Bio-Rad, Hercules, CA, USA) run under denatured and reducing conditions.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Tumstatin/COL4A3 Antibody (NBP1-85836)

Discover related pathways, diseases and genes to Tumstatin/COL4A3 Antibody (NBP1-85836). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Tumstatin/COL4A3 Antibody (NBP1-85836)

Discover more about diseases related to Tumstatin/COL4A3 Antibody (NBP1-85836).
 

Pathways for Tumstatin/COL4A3 Antibody (NBP1-85836)

View related products by pathway.

PTMs for Tumstatin/COL4A3 Antibody (NBP1-85836)

Learn more about PTMs related to Tumstatin/COL4A3 Antibody (NBP1-85836).

Blogs on Tumstatin/COL4A3

There are no specific blogs for Tumstatin/COL4A3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Tumstatin/COL4A3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol COL4A3
Entrez