TULA/STS-2 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

TULA/STS-2 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TULA/STS-2
  
  

  Source: E.coli

  Amino Acid Sequence: KSVLVVRHGERVDQIFGKAWLQQCSTPDGKYYRPDLNFPCSLPRRSRGIKDFENDPPLSSCGIFQSRIA

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: UBASH3A
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-25210It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TULA/STS-2 Recombinant Protein Antigen

• Cbl-interacting protein 4
• gene similar to UBA containing SH3 domain10CLIP4STS-2T-cell ubiquitin ligand protein
• STS2
• Suppressor of T-cell receptor signaling 2
• T-cell ubiquitin ligand
• TULAubiquitin-associated and SH3 domain-containing protein A
• ubiquitin associated and SH3 domain containing A

Background

UBASH3A, ubiquitin associated and SH3 domain containing, A, interferes with CBL-mediated down-regulation and degradation of receptor-type tyrosine kinases. Promotes accumulation of activated target receptors, such as T-cell receptors, EGFR and PDGFRB, on the cell surface (referenced from Swiss Prot).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: UBASH3A