Recombinant Human Tubulin Beta 4 Protein

Images

 
SDS-Page: Recombinant Human Tubulin Beta 4 Protein [H00010382-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Tubulin Beta 4 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-444 of Human TUBB4 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGNYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQPGAGNNWAKGHYTEGAELVDAVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEFPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLSVQSKNSSYFVEWIPNNVKTAVCDIPPRGLKMAATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEGEFEEEAEEEVA

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
TUBB4A

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Tubulin Beta 4 Protein

  • TUBB5beta-5
  • Tubulin 5 beta
  • tubulin beta-4 chain
  • tubulin, beta 4
  • tubulin, beta, 5

Background

TUBB4( AAH06570, 1 a.a. - 445 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15581
Species: Hu, Mu, Rt, Dr
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14886
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB1195
Species: Multi
Applications: WB, Simple Western, ICC
NBP2-46250
Species: Hu, Mu, Ca, Mk
Applications: WB, IHC, IF
NB600-936
Species: Hu, Mu, Rt, Po, Bv, Ch, ChHa, In, Pm, Xp, Ze
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-46245
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC, IF
NBP2-32875
Species: Hu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
MAB4218
Species: Hu
Applications: WB, IHC
NBP2-57274
Species: Hu
Applications: WB, ICC/IF
NBP1-33527
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-690
Species: Hu, Mu, Rt, Po, Av, Bv, Ca, Ch, ChHa, Dr, Fu, GP, Ha, Mk, Pa, Pm, Rb, Xp, Ye
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IM, IP, CyTOF-ready, IF
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
AF972
Species: Hu
Applications: WB, Simple Western, IHC
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33002
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB120-22711
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-90954
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-1293
Species: Hu, Mu, Rt, Am, Bv, Ca, Ch, Tr
Applications: WB, ICC/IF, IHC, IHC-Fr
AF7177
Species: Hu
Applications: WB, ICC

Publications for Tubulin Beta 4 Recombinant Protein (H00010382-P01) (0)

There are no publications for Tubulin Beta 4 Recombinant Protein (H00010382-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Tubulin Beta 4 Recombinant Protein (H00010382-P01) (0)

There are no reviews for Tubulin Beta 4 Recombinant Protein (H00010382-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Tubulin Beta 4 Recombinant Protein (H00010382-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Tubulin Beta 4 Products

Bioinformatics Tool for Tubulin Beta 4 Recombinant Protein (H00010382-P01)

Discover related pathways, diseases and genes to Tubulin Beta 4 Recombinant Protein (H00010382-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for Tubulin Beta 4 Recombinant Protein (H00010382-P01)

Find related products by research area.

Blogs on Tubulin Beta 4

There are no specific blogs for Tubulin Beta 4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Tubulin Beta 4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TUBB4A