TUBGCP5 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TUBGCP5 Antibody [NBP2-55676] - Staining of human cell line U-251 MG shows localization to cytosol & centrosome.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TUBGCP5 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SLYTLFLESVQSRLRHGEDSTPQVLTEQQATKENLMKMQSIAESHLELDDVHDPLLAINFARMYLEQSDFHEKFAGGDVCVDRSSESVTCQTFELTLRSC
Specificity
Specificity of human TUBGCP5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TUBGCP5
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TUBGCP5 Recombinant Protein Antigen (NBP2-55676PEP)

Reactivity Notes

Mouse 85%, Rat 87%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for TUBGCP5 Antibody

  • gamma-tubulin complex component 5
  • gamma-tubulin complex component GCP5
  • GCP5KIAA1899GCP-5
  • tubulin, gamma complex associated protein 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-49510
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-93476
Species: Hu
Applications: IHC, IHC-P
NBP2-16060
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-90313
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81841
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-45057
Species: Hu, Mu, Rt, Po
Applications: WB, ICC/IF, IHC, IHC-P
MAB333
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
AF674
Species: Hu
Applications: WB, Simple Western, Neut
NBP1-92547
Species: Hu
Applications: WB, IHC, IHC-P
NB100-481
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-92548
Species: Hu
Applications: IHC, IHC-P
NBP1-47470
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
NB500-240
Species: Hu, Mu
Applications: WB, IP
NBP1-89102
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30779
Species: Hu
Applications: IHC, IHC-P
AF638
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-22377
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-55676
Species: Hu
Applications: ICC/IF

Publications for TUBGCP5 Antibody (NBP2-55676) (0)

There are no publications for TUBGCP5 Antibody (NBP2-55676).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TUBGCP5 Antibody (NBP2-55676) (0)

There are no reviews for TUBGCP5 Antibody (NBP2-55676). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TUBGCP5 Antibody (NBP2-55676) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for TUBGCP5 Antibody (NBP2-55676)

Discover related pathways, diseases and genes to TUBGCP5 Antibody (NBP2-55676). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TUBGCP5 Antibody (NBP2-55676)

Discover more about diseases related to TUBGCP5 Antibody (NBP2-55676).
 

Pathways for TUBGCP5 Antibody (NBP2-55676)

View related products by pathway.

PTMs for TUBGCP5 Antibody (NBP2-55676)

Learn more about PTMs related to TUBGCP5 Antibody (NBP2-55676).

Blogs on TUBGCP5

There are no specific blogs for TUBGCP5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TUBGCP5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TUBGCP5