TUBGCP3 Antibody

Images

 
Western Blot: TUBGCP3 Antibody [NBP1-92547] - Analysis in control (vector only transfected HEK293T lysate) and TUBGCP3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunohistochemistry-Paraffin: TUBGCP3 Antibody [NBP1-92547] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TUBGCP3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LLSVLHSQLQLEDDQGVNLGLESSLTLRRLLVWTYDPKIRLKTLAALVDHCQGRKGGELASAVHAYTKTGDPYMRSLVQHILSLVSHPVLSFLYRWIYDGELEDTYHEFFVASDPTVKT
Predicted Species
Mouse (99%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TUBGCP3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TUBGCP3 Protein (NBP1-92547PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TUBGCP3 Antibody

  • Gamma-ring complex protein 104 kDa
  • gamma-tubulin complex component 3
  • GCP-3
  • GCP3h104p
  • hGCP3
  • hGrip104
  • hSpc98
  • SPBC98
  • Spc98p
  • Spindle pole body protein Spc98 homolog
  • tubulin, gamma complex associated protein 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81841
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-45057
Species: Ca, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAB333
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Neut, WB
NBP2-16628
Species: Hu, Mu
Applications: ICC/IF, IHC-Fr, WB
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-15669
Species: Hu, Mu, Rt
Applications: IHC, WB
H00121441-M05
Species: Bv, Hu, Mu, Po, Rt, Sh
Applications: ELISA, IB, ICC/IF, IHC, IHC-P, WB
NBP1-87772
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-89166
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00027349-M01
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
H00114791-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-19807
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB400-114
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
NBP1-88468
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-83319
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-94428
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-92547
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for TUBGCP3 Antibody (NBP1-92547) (0)

There are no publications for TUBGCP3 Antibody (NBP1-92547).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TUBGCP3 Antibody (NBP1-92547) (0)

There are no reviews for TUBGCP3 Antibody (NBP1-92547). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TUBGCP3 Antibody (NBP1-92547) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TUBGCP3 Products

Bioinformatics Tool for TUBGCP3 Antibody (NBP1-92547)

Discover related pathways, diseases and genes to TUBGCP3 Antibody (NBP1-92547). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TUBGCP3 Antibody (NBP1-92547)

Discover more about diseases related to TUBGCP3 Antibody (NBP1-92547).
 

Pathways for TUBGCP3 Antibody (NBP1-92547)

View related products by pathway.

Research Areas for TUBGCP3 Antibody (NBP1-92547)

Find related products by research area.

Blogs on TUBGCP3

There are no specific blogs for TUBGCP3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TUBGCP3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TUBGCP3