TTC39B Antibody

Images

 
Immunohistochemistry: TTC39B Antibody [NBP2-49150] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TTC39B Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LKGCCLKNLQRPLQAELCYNHVVESEKLLKYDHYLVPFTLFELASLYKSQGEIDKAIKFLETARNNYKDYS
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TTC39B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TTC39B Recombinant Protein Antigen (NBP2-49150PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TTC39B Antibody

  • C9orf52
  • chromosome 9 open reading frame 52
  • FLJ33868
  • tetratricopeptide repeat domain 39B
  • tetratricopeptide repeat protein 39B
  • TPR repeat protein 39B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45718
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
AF3485
Species: Hu, Pm
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), WB
NBP1-71706
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
NB300-558
Species: Bv, Hu, Rb
Applications: ELISA, ICC/IF, IP, WB
NBP1-33596
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, PAGE, WB
AF2929
Species: Hu
Applications: IHC, WB
NBP1-05950
Species: Hu, Mu
Applications: ICC/IF, WB
NB400-105
Species: Ca, Ch, ChHa, Eq, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt
Applications: B/N, ChIP, Dual ISH-IHC, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, PCR, Simple Western, WB
NB400-106
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89679
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
NBP2-49150
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for TTC39B Antibody (NBP2-49150) (0)

There are no publications for TTC39B Antibody (NBP2-49150).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TTC39B Antibody (NBP2-49150) (0)

There are no reviews for TTC39B Antibody (NBP2-49150). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TTC39B Antibody (NBP2-49150) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TTC39B Products

Bioinformatics Tool for TTC39B Antibody (NBP2-49150)

Discover related pathways, diseases and genes to TTC39B Antibody (NBP2-49150). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TTC39B Antibody (NBP2-49150)

Discover more about diseases related to TTC39B Antibody (NBP2-49150).

Blogs on TTC39B

There are no specific blogs for TTC39B, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TTC39B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TTC39B