TTC21B Antibody

Images

 
Western Blot: TTC21B Antibody [NBP1-90416] - Analysis in human cell line SCLC-21H.
Immunocytochemistry/ Immunofluorescence: TTC21B Antibody [NBP1-90416] - Staining of human cell line A-431 shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: TTC21B Antibody [NBP1-90416] - Staining of human fallopian tube shows cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity Hu, ZeSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TTC21B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ALAHEPVNELSALMEDGRCQVLLAKVYSKMEKLGDAITALQQARELQARVLKRVQMEQPDAVPAQKHLAAEICAEIAKHSVAQRDYE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TTC21B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TTC21B Protein (NBP1-90416PEP)
Publications
Read Publication using
NBP1-90416 in the following applications:

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (86%). Zebrafish reactivity reported in scientific literature (PMID: 25860617).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TTC21B Antibody

  • ATD4
  • JBTS11
  • KIAA1992
  • putative protein product of Nbla10696
  • tetratricopeptide repeat domain 21B
  • tetratricopeptide repeat protein 21B
  • THM1
  • TPR repeat protein 21B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88691
Species: Hu
Applications: WB, IHC, IHC-P
423-F8/CF
Species: Hu, Mu
NBP2-20891
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF3690
Species: Hu, Mu
Applications: WB, ChIP, ICC
NBP1-90686
Species: Hu
Applications: IHC, IHC-P
NBP2-24543
Species: Hu, Mu, Pm
Applications: WB, IHC-P
NBP1-89910
Species: Hu
Applications: IHC, IHC-P
NB600-600
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P, Flow-IC
NBP1-06590
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-92019
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15309
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2475
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-90189
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87014
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82883
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for TTC21B Antibody (NBP1-90416)(1)

We have publications tested in 1 confirmed species: Zebrafish.

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(1)
All Applications
Filter By Species
Zebrafish
(1)
All Species

Reviews for TTC21B Antibody (NBP1-90416) (0)

There are no reviews for TTC21B Antibody (NBP1-90416). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TTC21B Antibody (NBP1-90416) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TTC21B Products

Bioinformatics Tool for TTC21B Antibody (NBP1-90416)

Discover related pathways, diseases and genes to TTC21B Antibody (NBP1-90416). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TTC21B Antibody (NBP1-90416)

Discover more about diseases related to TTC21B Antibody (NBP1-90416).
 

Pathways for TTC21B Antibody (NBP1-90416)

View related products by pathway.

Blogs on TTC21B

There are no specific blogs for TTC21B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TTC21B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TTC21B