TTC21B Antibody - BSA Free

Staining of human cell line A-431 shows localization to mitochondria.

Immunohistochemistry-Paraffin: TTC21B Antibody [NBP1-90416] - Staining of human testis shows weak cytoplasmic/membranous positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: TTC21B Antibody [NBP1-90416] - Staining of human colon shows strong membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: TTC21B Antibody [NBP1-90416] - Staining of human fallopian tube shows moderate to strong membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: TTC21B Antibody [NBP1-90416] - Staining of human liver shows no positivity in hepatocytes as expected.

• Reactivity: Hu, Ze
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TTC21B Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TTC21B Antibody - BSA Free (NBP1-90416) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-TTC21B Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ALAHEPVNELSALMEDGRCQVLLAKVYSKMEKLGDAITALQQARELQARVLKRVQMEQPDAVPAQKHLAAEICAEIAKHSVAQRDYE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TTC21B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  TTC21B Protein (NBP1-90416PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (86%). Zebrafish reactivity reported in scientific literature (PMID: 25860617).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TTC21B Antibody - BSA Free

• ATD4
• JBTS11
• KIAA1992
• putative protein product of Nbla10696
• tetratricopeptide repeat domain 21B
• tetratricopeptide repeat protein 21B
• THM1
• TPR repeat protein 21B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TTC21B Antibody (NBP1-90416)(2)

Publications using NBP1-90416

• Quidwai T, Wang J, Hall EA et al. A WDR35-dependent coat protein complex transports ciliary membrane cargo vesicles to cilia eLife 2021-11-04 [PMID: 34734804] (Immunocytochemistry/ Immunofluorescence, Fish - Danio rerio (Zebrafish))
• Xu Y, Cao J, Huang S et al. Characterization of Tetratricopeptide Repeat-Containing Proteins Critical for Cilia Formation and Function. PLoS One 2015-01-01 [PMID: 25860617] (ICC/IF, Zebrafish)

Bioinformatics

• Gene Symbol: TTC21B