TTC1 Antibody (4E3.)

Images

 
Immunohistochemistry-Paraffin: TTC1 Antibody (4E3) [H00007265-M01] - Analysis of monoclonal antibody to TTC1 on formalin-fixed paraffin-embedded human liver. Antibody concentration 1.5 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC-P
Clone
4E3.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TTC1 Antibody (4E3.) Summary

Immunogen
TTC1 (NP_003305 193 a.a. - 292 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LRRAELYEKTDKLDEALEDYKSILEKDPSIHQAREACMRLPKQIEERNERLKEEMLGKLKDLGNLVLRPFGLSTENFQIKQDSSTGSYSINFVQNPNNNR
Specificity
TTC1 (4E3)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TTC1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. It has been used for IHC-P.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TTC1 Antibody (4E3.)

  • FLJ46404
  • tetratricopeptide repeat domain 1
  • tetratricopeptide repeat protein 1
  • TPR1TPR repeat protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00010963-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-2866
Species: Hu
Applications: WB, ICC/IF, IP, PLA
NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86920
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB120-2813
Species: Hu, Mu, Ch, Rb
Applications: WB, ICC/IF, IP
NBP1-97503
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, GP, Ha, Md, Pm, Rb, Sh, Xp
Applications: WB, IHC, IHC-P, IP
NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-97868
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, GP, Ha, Mk, Rb, Sh
Applications: WB, EM, EIA, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-22471
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-83132
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-53125
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03433
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-02459
Species: Hu, Mu, Rt, Ch, Dr, Pm
Applications: WB, ELISA, IHC, IHC-P
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
AF6260
Species: Hu
Applications: WB
MAB4540
Species: Hu, Mu, Rt
Applications: WB, IHC
MAB2476
Species: Hu
Applications: WB, IHC

Publications for TTC1 Antibody (H00007265-M01) (0)

There are no publications for TTC1 Antibody (H00007265-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TTC1 Antibody (H00007265-M01) (0)

There are no reviews for TTC1 Antibody (H00007265-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TTC1 Antibody (H00007265-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TTC1 Products

Bioinformatics Tool for TTC1 Antibody (H00007265-M01)

Discover related pathways, diseases and genes to TTC1 Antibody (H00007265-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TTC1 Antibody (H00007265-M01)

Discover more about diseases related to TTC1 Antibody (H00007265-M01).
 

Pathways for TTC1 Antibody (H00007265-M01)

View related products by pathway.

PTMs for TTC1 Antibody (H00007265-M01)

Learn more about PTMs related to TTC1 Antibody (H00007265-M01).

Blogs on TTC1

There are no specific blogs for TTC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TTC1 Antibody (4E3.) and receive a gift card or discount.

Bioinformatics

Gene Symbol TTC1
Entrez
OMIM
Uniprot