TSSC1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TSSC1 Antibody [NBP2-58684] - Staining of human cell line MCF7 shows localization to nucleus & nucleoli.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TSSC1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: WSPHHNCTQVATANDTTLRGWDTRSMSQIYCIENAHGQLVRDLDFNPNKQYYLASCGDDCKVKFWDTRNVTEPVKTLEEHSHWVWNVRYNH
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EIPR1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TSSC1 Recombinant Protein Antigen (NBP2-58684PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for TSSC1 Antibody

  • protein TSSC1
  • tumor suppressing subtransferable candidate 1
  • Tumor-suppressing STF cDNA 1 protein
  • Tumor-suppressing subchromosomal transferable fragment candidate gene 1 protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006786-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP2-36543
Species: Hu
Applications: IP, WB
NBP1-89917
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-12897
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
NBP1-84969
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP2-14081
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB500-207
Species: Hu
Applications: ICC/IF, IP, WB
NBP2-16991
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NB500-212
Species: Hu
Applications: ICC/IF, IP, KD, WB
NBP1-81293
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NB100-93325
Species: Hu
Applications: ICC/IF, IP, WB
NBP2-20231
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
H00029883-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP1-97512
Species: Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NB100-1347
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NBP2-92677
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP1-84382
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-58684
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for TSSC1 Antibody (NBP2-58684) (0)

There are no publications for TSSC1 Antibody (NBP2-58684).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TSSC1 Antibody (NBP2-58684) (0)

There are no reviews for TSSC1 Antibody (NBP2-58684). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TSSC1 Antibody (NBP2-58684) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TSSC1 Products

Bioinformatics Tool for TSSC1 Antibody (NBP2-58684)

Discover related pathways, diseases and genes to TSSC1 Antibody (NBP2-58684). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TSSC1 Antibody (NBP2-58684)

Discover more about diseases related to TSSC1 Antibody (NBP2-58684).
 

Pathways for TSSC1 Antibody (NBP2-58684)

View related products by pathway.

Blogs on TSSC1

There are no specific blogs for TSSC1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TSSC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EIPR1