TSSC1 Antibody - BSA Free

Western Blot: TSSC1 Antibody [NBP1-85927] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11, Lane 2: Human cell line RT-4, Lane 3: Human cell line U-251MG sp

Immunohistochemistry-Paraffin: TSSC1 Antibody [NBP1-85927] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TSSC1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TSSC1 Antibody - BSA Free (NBP1-85927) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VILSNMVSISSEPFGHLVDDDDISDQEDHRSEEKSKEPLQDNVIATYEEHEDSVYAVDWSSADPWLFASLSYDGRLVINRVPRALKYH
• Predicted Species: Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EIPR1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  TSSC1 Protein (NBP1-85927PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TSSC1 Antibody - BSA Free

• protein TSSC1
• tumor suppressing subtransferable candidate 1
• Tumor-suppressing STF cDNA 1 protein
• Tumor-suppressing subchromosomal transferable fragment candidate gene 1 protein

Background

TSSC1 has been reported in PMID 9403053 as one of several tumor-suppressing subtransferable fragments located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. Alignment of this gene to genomic sequence data suggests that this gene may reside on chromosome 2 rather than chromosome 11.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EIPR1