Recombinant Human TSPAN9 Protein

Images

 
SDS-Page: Recombinant Human TSPAN9 Protein [H00010867-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE

Order Details

Recombinant Human TSPAN9 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-157 of Human TSPAN9 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MWGRPTFEQSCPALVPWPGFLVRSFSRLRRNPQSADSGADTSGRRDSADKCCSCTVGPGASCVFCCGWGGWVGLCLSMQFLIFVNINSKSLVHWEMCNLPENLFCFWSTSGVASGPRAFATVLPPAPTSSVCLQSLIYRSPRCLLYSLCAWPFCYLA

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
TSPAN9

Applications/Dilutions

Application Notes
Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Preservative
No Preservative

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TSPAN9 Protein

  • NET5
  • NET-5
  • NET5tetraspanin-9
  • new EST tetraspan 5
  • PP1057
  • Tetraspan NET-5
  • tetraspanin 9
  • transmembrane 4 superfamily member tetraspan NET-5
  • TSPAN9
  • tspan-9

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBL1-17057
Species: Hu
NBP2-22187
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, IF
NBP2-59942
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP2-25151
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP1-77126
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
MAB197
Species: Hu
Applications: Flow, CyTOF-reported, ICC, Neut
NBP2-24716
Species: Hu, Pm
Applications: WB, IHC-P
NBP1-89818
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB1106
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP2-02211
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-76941
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
28100002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
H00007004-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IP, RNAi
MAB1233
Species: Hu
Applications: Flow, IP, CyTOF-ready, ICC
NBP2-59944
Species: Hu
Applications: WB, ICC/IF
H00010867-P01
Species: Hu
Applications: WB, ELISA, PA, PAGE

Publications for TSPAN9 Recombinant Protein (H00010867-P01) (0)

There are no publications for TSPAN9 Recombinant Protein (H00010867-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TSPAN9 Recombinant Protein (H00010867-P01) (0)

There are no reviews for TSPAN9 Recombinant Protein (H00010867-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TSPAN9 Recombinant Protein (H00010867-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TSPAN9 Products

Bioinformatics Tool for TSPAN9 Recombinant Protein (H00010867-P01)

Discover related pathways, diseases and genes to TSPAN9 Recombinant Protein (H00010867-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TSPAN9 Recombinant Protein (H00010867-P01)

Discover more about diseases related to TSPAN9 Recombinant Protein (H00010867-P01).
 

Pathways for TSPAN9 Recombinant Protein (H00010867-P01)

View related products by pathway.

PTMs for TSPAN9 Recombinant Protein (H00010867-P01)

Learn more about PTMs related to TSPAN9 Recombinant Protein (H00010867-P01).

Blogs on TSPAN9

There are no specific blogs for TSPAN9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

TSPAN9 Antibody
NBP1-81003
c-Myc Antibody
NB600-335

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TSPAN9 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TSPAN9
Entrez