TSPAN9 Antibody

Western Blot: TSPAN9 Antibody [NBP1-81003] - Analysis in control (vector only transfected HEK293T lysate) and TSPAN9 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunocytochemistry/Immunofluorescence: TSPAN9 Antibody [NBP1-81003] - Staining of human cell line U-2 OS shows localization to nucleoplasm, cytosol & the Golgi apparatus.

Immunohistochemistry-Paraffin: TSPAN9 Antibody [NBP1-81003] - Staining of human heart muscle shows moderate positivity in intercalated discs.

Product Discontinued

TSPAN9 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LLLYHTENNVGLKNAWNIIQAEMRCCGVTDYTDWYPVLGENTVPDRCCMENSQGCGRNATTPLWRTGCYEKVKMWFDD
• Predicted Species: Mouse (96%), Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TSPAN9
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  TSPAN9 Recombinant Protein Antigen (NBP1-81003PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TSPAN9 Antibody

• NET5
• NET-5
• NET5tetraspanin-9
• new EST tetraspan 5
• PP1057
• Tetraspan NET-5
• tetraspanin 9
• transmembrane 4 superfamily member tetraspan NET-5
• TSPAN9
• tspan-9

Background

The protein encoded by the Tetraspanin-9 gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. Alternatively spliced transcripts encoding the same protein have been identified. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TSPAN9
• Entrez:
  • 10867(Human)
• Uniprot:
  • O75954()
  • O75954()
  • O75954()
  • O75954()