TSPAN8/TM4SF3 Antibody (1E5)

Images

 
Western Blot: TSPAN8/TM4SF3 Antibody (1E5) [H00007103-M02] - Analysis of TSPAN8 expression in transfected 293T cell line by TSPAN8 monoclonal antibody (M02), clone 1E5.Lane 1: TSPAN8 transfected lysate (Predicted MW: ...read more
Immunocytochemistry/ Immunofluorescence: TSPAN8/TM4SF3 Antibody (1E5) [H00007103-M02] - Analysis of monoclonal antibody to TSPAN8 on 293 cell. Antibody concentration 10 ug/ml.
Western Blot: TSPAN8/TM4SF3 Antibody (1E5) [H00007103-M02] - detection against Immunogen (36.67 KDa).
Western Blot: TSPAN8/TM4SF3 Antibody (1E5) [H00007103-M02] - 3 human pancreas cancer cell lines. Image from verified customer review.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, S-ELISA
Clone
1E5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TSPAN8/TM4SF3 Antibody (1E5) Summary

Immunogen
TSPAN8 (NP_004607, 110 a.a. ~ 205 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KSKSDRIVNETLYENTKLLSATGESEKQFQEAIIVFQEEFKCCGLVNGAADWGNNFQHYPELCACLDKQRPCQSYNGKQVYKETCISFIKDFLAKN
Specificity
TSPAN8 (1E5)
Isotype
IgG3 Lambda
Clonality
Monoclonal
Host
Mouse
Gene
TSPAN8
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Sandwich ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Reviewed Applications
Read 1 Review rated 5
using
H00007103-M02 in the following applications:

Publications
Read Publication using H00007103-M02.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TSPAN8/TM4SF3 Antibody (1E5)

  • CO-029
  • tetraspanin 8
  • TM4SF3
  • TM4SF3tspan-8
  • Transmembrane 4 superfamily member 3tetraspanin-8
  • TSPAN8
  • Tspan-8
  • Tumor-associated antigen CO-029

Background

The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins. This gene is expressed in different carcinomas. The use of alternate polyadenylation sites has been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB500-327
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, In vitro, CyTOF-ready
NBP2-42225
Species: Hu, Ca
Applications: WB, DB, EM, ELISA, Flow, Func, ICC/IF, IP, In vitro, Flow-IC, IHC-WhMt
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-45041
Species: Hu, Po
Applications: Flow, IHC, IHC-Fr, IF
NB600-1182
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-57403
Species: Hu
Applications: WB, ICC/IF
NBP2-93002
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-82916
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-28869
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-64810
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-Fr, IHC-P, IP
AF1190
Species: Rt
Applications: WB, Flow, IHC, Block, CyTOF-ready
NBP2-45600
Species: Hu, Ca, Pm
Applications: WB, IHC, IF
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-85589
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-21792
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
H00006934-M06
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NB500-393
Species: Hu
Applications: WB, Flow, IHC, IHC-Fr, IP, CyTOF-ready
NBP1-89680
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, ChIP
H00007103-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA

Publications for TSPAN8/TM4SF3 Antibody (H00007103-M02)(1)

Review for TSPAN8/TM4SF3 Antibody (H00007103-M02) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using H00007103-M02:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot TSPAN8/TM4SF3 H00007103-M02
Enlarge
5
reviewed by:
Ming Lu
WB Human 07/03/2014
View

Summary

ApplicationWestern Blot
Sample Tested3 human pancreas cancer cell lines
SpeciesHuman
LotD5031-1E5
CommentsTSPAN8 is not easy to detect by western because it is a hydrophobic protein. I tried several antibodies, this one from Novus worked the best. Although the background is not super clean as monoclonal antibody should be, but it worked with only 15ug protein loaded so I give it a 5 star.

Blocking

Blocking Details2% BSA in PBS buffer.

Primary Anitbody

Dilution RatioTM4SF3 Antibody (1E5), 1:250 dilution 4C overnight

Secondary Antibody

Secondary Descriptiongoat anti mouse IgG HRP
Secondary Manufacturer Cat#Cellsignaling, Cat# 7076S
Secondary Concentration1:3000

Details

Detection NotesECL, exposure time 5 min

Comments

CommentsTSPAN8 is not easy to detect by western because it is a hydrophobic protein. I tried several antibodies, this one from Novus worked the best. Although the background is not super clean as monoclonal antibody should be, but it worked with only 15ug protein loaded so I give it a 5 star.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TSPAN8/TM4SF3 Antibody (H00007103-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TSPAN8/TM4SF3 Products

Bioinformatics Tool for TSPAN8/TM4SF3 Antibody (H00007103-M02)

Discover related pathways, diseases and genes to TSPAN8/TM4SF3 Antibody (H00007103-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TSPAN8/TM4SF3 Antibody (H00007103-M02)

Discover more about diseases related to TSPAN8/TM4SF3 Antibody (H00007103-M02).
 

Pathways for TSPAN8/TM4SF3 Antibody (H00007103-M02)

View related products by pathway.

PTMs for TSPAN8/TM4SF3 Antibody (H00007103-M02)

Learn more about PTMs related to TSPAN8/TM4SF3 Antibody (H00007103-M02).
 

Research Areas for TSPAN8/TM4SF3 Antibody (H00007103-M02)

Find related products by research area.

Blogs on TSPAN8/TM4SF3

There are no specific blogs for TSPAN8/TM4SF3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Ming Lu
07/03/2014
Application: WB
Species: Human

Bioinformatics

Gene Symbol TSPAN8
Entrez
OMIM
Uniprot