TSG Antibody (2F3)

Images

 
Western Blot: TSG Antibody (2F3) [H00057045-M07] - Analysis of TWSG1 expression in human kidney.
Sandwich ELISA: TSG Antibody (2F3) [H00057045-M07] - Detection limit for recombinant GST tagged TWSG1 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC, IHC-P, S-ELISA
Clone
2F3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TSG Antibody (2F3) Summary

Immunogen
TWSG1 (AAH20490, 1 a.a. ~ 223 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MKLHYVAVLTLAILMFLTWLPESLSCNKALCASDVSKCLIQELCQCRPGEGNCSCCKECMLCLGALWDECCDCVGMCNPRNYSDTPPTSKSTVEELHEPIPSLFRALTEGDTQLNWNIVSFPVAEELSHHENLVSFLETVNQPHHQNVSVPSNNVHAPYSSDKEHMCTVVYFDDCMSIHQCKISCESMGASKYRWFHNACCECIGPECIDYGSKTVKCMNCMF
Specificity
TWSG1 - twisted gastrulation homolog 1 (Drosophila) (2F3)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TWSG1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Publications
Read Publication using H00057045-M07.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TSG Antibody (2F3)

  • TSG
  • TSGtwisted gastrulation protein homolog 1
  • twisted gastrulation homolog 1 (Drosophila)
  • TWSG1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
314-BP
Species: Hu
Applications: BA, BA
NBP2-03644
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
758-CN/CF
Species: Mu
Applications: BA
NBP1-89062
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-92546
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP2-45603
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NBP2-67338
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-59774
Species: Hu
Applications: ChIP, IHC, IHC-P, IP, WB
355-BM/CF
Species: Hu, Mu, Rt
Applications: BA
AF748
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-41384
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
AF2299
Species: Mu
Applications: IHC, WB
MAB847
Species: Hu, Mu
Applications: CyTOF-ready, IHC, ICFlow, KO, WB
NB600-335
Species: All-NA
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NB100-404
Species: Hu
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, KD, KO, WB
H00051364-P01
Species: Hu
Applications: ELISA, AP, PA, WB
H00057045-M07
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA

Publications for TSG Antibody (H00057045-M07)(1)

Reviews for TSG Antibody (H00057045-M07) (0)

There are no reviews for TSG Antibody (H00057045-M07). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TSG Antibody (H00057045-M07) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TSG Products

Bioinformatics Tool for TSG Antibody (H00057045-M07)

Discover related pathways, diseases and genes to TSG Antibody (H00057045-M07). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TSG Antibody (H00057045-M07)

Discover more about diseases related to TSG Antibody (H00057045-M07).
 

Pathways for TSG Antibody (H00057045-M07)

View related products by pathway.

PTMs for TSG Antibody (H00057045-M07)

Learn more about PTMs related to TSG Antibody (H00057045-M07).

Blogs on TSG

There are no specific blogs for TSG, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TSG Antibody (2F3) and receive a gift card or discount.

Bioinformatics

Gene Symbol TWSG1
Entrez
Uniprot