sen15 Antibody

Images

 
Western Blot: sen15 Antibody [NBP1-89888] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunocytochemistry/ Immunofluorescence: sen15 Antibody [NBP1-89888] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & nucleoli fibrillar center.
Immunohistochemistry-Paraffin: sen15 Antibody [NBP1-89888] - Staining of human esophagus shows distinct nucleolar positivity in squamous epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

sen15 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EERGDSEPTPGCSGLGPDGVRGFGDGGGAPSWAPEDAWMGTHPKYLEMMELDIGDATHVYVAFLVYLDLMESK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TSEN15
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
  • Immunofluorescence
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
sen15 Protein (NBP1-89888PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (84%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for sen15 Antibody

  • C1orf19
  • chromosome 1 open reading frame 19
  • hsSen15
  • SEN15 homolog
  • sen15
  • tRNA splicing endonuclease 15 homolog (S. cerevisiae)
  • tRNA-intron endonuclease Sen15
  • tRNA-splicing endonuclease subunit Sen15

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-30377
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81140
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00079042-B01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-80886
Species: Hu
Applications: WB, IHC, IHC-P
NB100-122
Species: Hu, Mu, Rt, Fi, Ha, Pm, Sh
Applications: WB, Simple Western, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO
NBP2-56333
Species: Hu
Applications: WB, ICC/IF
H00001848-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP2-16861
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19775
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-97494
Species: Hu, Mu, Rt, Bv, Ch
Applications: WB, ICC/IF, IHC, IHC-P
1341-WF/CF
Species: Hu
NBP1-85702
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59450
Species: Hu
Applications: WB
AF4070
Species: Hu
Applications: WB, ICC
NBP1-30042
Species: Hu, Mu, Rt, Ch, Rb
Applications: WB, ICC/IF, IHC, IHC-P

Publications for sen15 Antibody (NBP1-89888) (0)

There are no publications for sen15 Antibody (NBP1-89888).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for sen15 Antibody (NBP1-89888) (0)

There are no reviews for sen15 Antibody (NBP1-89888). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for sen15 Antibody (NBP1-89888) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional sen15 Products

Bioinformatics Tool for sen15 Antibody (NBP1-89888)

Discover related pathways, diseases and genes to sen15 Antibody (NBP1-89888). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for sen15 Antibody (NBP1-89888)

Discover more about diseases related to sen15 Antibody (NBP1-89888).

Blogs on sen15

There are no specific blogs for sen15, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our sen15 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TSEN15