TSC2 Antibody (7X2C6)

Western Blot: TSC2 Antibody (7X2C6) [NBP3-15763] - Western blot analysis of extracts of various cell lines, using TSC2 antibody (NBP3-15763) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.

Immunoprecipitation: TSC2 Antibody (7X2C6) [NBP3-15763] - Immunoprecipitation analysis of 300ug extracts of 293T cells using 3ug TSC2 antibody (NBP3-15763). Western blot was performed from the immunoprecipitate using TSC2 antibody (NBP3-15763) at a dilition of 1:1000.

• Reactivity: Hu
• Applications: WB, IP
• Clone: 7X2C6
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

TSC2 Antibody (7X2C6) Summary

• Description: Novus Biologicals Rabbit TSC2 Antibody (7X2C6) (NBP3-15763) is a recombinant monoclonal antibody validated for use in WB and IP. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1700-1807 of human Tuberin (P49815). AKIVSDRNLPFVARQMALHANMASQVHHSRSNPTDIYPSKWIARLRHIKRLRQRICEEAAYSNPSLPLVHPPSHSKAPAQTPAEPTPGYEVGQRKRLISSVEDFTEFV
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: TSC2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunoprecipitation 1:500 - 1:1000
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TSC2 Antibody (7X2C6)

• LAM
• LAMFLJ43106
• TSC2
• TSC4
• Tuberin
• Tuberous sclerosis 2 protein
• tuberous sclerosis 2

Background

Tuberous sclerosis complex-2 (TCS2 also known as Tuberin) is a tumor suppressor that forms a complex with TSC1 (Hamartin ) and this complex is known to control various cellular functions including cell cycle, endocytosis, adhesion, and transcription (1). The C-terminal region of TSC2 contains a GTPase-activating protein (GAP) domain which interacts with Rap1, Rab5 and Rheb (2). The TSC1/TSC2 complex inhibits phosphorylation of S6kinase and 4E-BP1 through inactivation of mTOR (3). Additionally, binding of 14-3-3 beta to TSC2 at Ser1210 reduce the ability of the complex to inhibit phosphorylation of S6 kinase (4). Phosphorylation by ATK at Ser924 and Thr1518 inactivates TSC2 and disrupts its interaction with TSC1 (5). Tuberous sclerosis (TSC), an autosomal dominant disorder that affects 1 in 6000 individuals, is caused by a mutation in either the TSC1 or TSC2 tumor suppressor gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TSC2