Recombinant Human TSC1 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human TSC1 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 166-274 of Human TSC1

Source: Wheat Germ

Amino Acid Sequence: LKKPGHVAEVYLVHLHASVYALFHRLYGMYPCNFVSFLRSHYSMKENLETFEEVVKPMMEHVRIHPELVTGSKDHELDPRRWKRLETHDVVIECAKISLDPTEASYEDG

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
TSC1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
37.73 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TSC1 Protein

  • Hamartin
  • KIAA0243MGC86987
  • LAMhamartin
  • TSC
  • TSC1
  • Tuberous sclerosis 1 protein
  • tuberous sclerosis 1
  • tumor suppressor

Background

TSC1 - tuberous sclerosis 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB40401
Species: Hu, Mu
Applications: WB, IHC, ICC
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA, ICC
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
H00006009-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA
NB100-1595
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF8962
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
AF847
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-46403
Species: Hu
Applications: IHC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-38535
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-157
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24503
Species: Hu, Mu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86376
Species: Hu
Applications: IHC, IHC-P
NBP2-14835
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89865
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-239
Species: Hu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
H00007248-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for TSC1 Partial Recombinant Protein (H00007248-Q01) (0)

There are no publications for TSC1 Partial Recombinant Protein (H00007248-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TSC1 Partial Recombinant Protein (H00007248-Q01) (0)

There are no reviews for TSC1 Partial Recombinant Protein (H00007248-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TSC1 Partial Recombinant Protein (H00007248-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TSC1 Products

Bioinformatics Tool for TSC1 Partial Recombinant Protein (H00007248-Q01)

Discover related pathways, diseases and genes to TSC1 Partial Recombinant Protein (H00007248-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TSC1 Partial Recombinant Protein (H00007248-Q01)

Discover more about diseases related to TSC1 Partial Recombinant Protein (H00007248-Q01).
 

Pathways for TSC1 Partial Recombinant Protein (H00007248-Q01)

View related products by pathway.

PTMs for TSC1 Partial Recombinant Protein (H00007248-Q01)

Learn more about PTMs related to TSC1 Partial Recombinant Protein (H00007248-Q01).
 

Research Areas for TSC1 Partial Recombinant Protein (H00007248-Q01)

Find related products by research area.

Blogs on TSC1.

TSC1 - a negative regulator of mTOR signaling
TSC1 is a tumor suppressor gene that encodes a 130 kDa protein called hamartin. TSC1 was first identified as an oncogenic driver of Tuberous Sclerosis, a condition characterized by numerous benign tumors of the skin, brain, heart, and lungs. A mut...  Read full blog post.

Customers Who Bought This Also Bought

4EBP1 Antibody
NB200-157

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TSC1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TSC1
Entrez