Tryptase beta-2/TPSB2 Recombinant Protein Antigen

Images

 
There are currently no images for Tryptase beta-2/TPSB2 Recombinant Protein Antigen (NBP2-33551PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Tryptase beta-2/TPSB2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Tryptase beta-2/TPSB2.

Source: E.coli

Amino Acid Sequence: VKVPIMENHICDAKYHLGAYTGDDVRIVRD

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TPSB2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33551.It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Tryptase beta-2/TPSB2 Recombinant Protein Antigen

  • EC 3.4.21
  • EC 3.4.21.59
  • mast cell tryptase beta II
  • mast cell tryptase beta III
  • TPS2
  • TPS2tryptase beta-2
  • TPSB2
  • Tryptase alpha/beta-1
  • tryptase beta 2 (gene/pseudogene)
  • tryptase beta 2
  • tryptase beta II
  • tryptase beta III
  • Tryptase beta2
  • Tryptase beta-2
  • Tryptase II
  • tryptase III
  • tryptase-2
  • tryptaseB
  • tryptaseC
  • Tryptase-C

Background

Tryptases comprise a family of trypsin-like serine proteases, the peptidase family S1. Tryptases are enzymatically active only as heparin-stabilized tetramers, and they are resistant to all known endogenous proteinase inhibitors. Several tryptase genes are clustered on chromosome 16p13.3. These genes are characterized by several distinct features. They have a highly conserved 3' UTR and contain tandem repeat sequences at the 5' flank and 3' UTR which are thought to play a role in regulation of the mRNA stability. These genes have an intron immediately upstream of the initiator Met codon, which separates the site of transcription initiation from protein coding sequence. This feature is characteristic of tryptases but is unusual in other genes. The alleles of this gene exhibit an unusual amount of sequence variation, such that the alleles were once thought to represent two separate genes, beta II and beta III. Beta tryptases appear to be the main isoenzymes expressed in mast cells, whereas in basophils, alpha-tryptases predominate. Tryptases have been implicated as mediators in the pathogenesis of asthma and other allergic and inflammatory disorders. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-26444
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, mIF, WB
NB100-108
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-82756
Species: Hu
Applications: IHC,  IHC-P
NBP3-25488
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
AF1356
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Simple Western, WB
NBP1-86644
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF4599
Species: Hu
Applications: IHC, IP, Simple Western, WB
NBP2-24915
Species: Bv, Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-01679
Species: Hu
Applications: Flow, IHC,  IHC-P, WB
NBP2-67232
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NB110-58358
Species: Ca, Hu, Mu, Rt, Ze
Applications: ChIP, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, KO, Simple Western, WB
NBP3-45748
Species: Hu, Mu
Applications: ELISA, IHC, IP, WB
NBP1-84020
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
H00000474-M01
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP2-16684
Species: Hu, Mu, Rt
Applications: EM, IHC,  IHC-P, WB
MAB5074
Species: Hu
Applications: WB
NB100-56176
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
MAB4099
Species: Hu
Applications: ELISA, IP, WB

Publications for Tryptase beta-2/TPSB2 Recombinant Protein Antigen (NBP2-33551PEP) (0)

There are no publications for Tryptase beta-2/TPSB2 Recombinant Protein Antigen (NBP2-33551PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Tryptase beta-2/TPSB2 Recombinant Protein Antigen (NBP2-33551PEP) (0)

There are no reviews for Tryptase beta-2/TPSB2 Recombinant Protein Antigen (NBP2-33551PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Tryptase beta-2/TPSB2 Recombinant Protein Antigen (NBP2-33551PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Tryptase beta-2/TPSB2 Products

Research Areas for Tryptase beta-2/TPSB2 Recombinant Protein Antigen (NBP2-33551PEP)

Find related products by research area.

Blogs on Tryptase beta-2/TPSB2

There are no specific blogs for Tryptase beta-2/TPSB2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Tryptase beta-2/TPSB2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TPSB2