Trypsin 2/PRSS2 Antibody

Images

 
Western Blot: Trypsin 2/PRSS2 Antibody [H00005645-B01P] - Analysis of PRSS2 expression in human pancreas.
Western Blot: Trypsin 2/PRSS2 Antibody [H00005645-B01P] - Analysis of PRSS2 expression in transfected 293T cell line by PRSS2 polyclonal antibody. Lane 1: PRSS2 transfected lysate(26.4 KDa). Lane 2: Non-transfected ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Trypsin 2/PRSS2 Antibody Summary

Immunogen
PRSS2 (AAH30260, 1 a.a. - 239 a.a.) full-length human protein. MNLLLILTFVAAAVAAPFDDDDKIVGGYICEENSVPYQVSLNSGYHFCGGSLISEQWVVSAGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPKYNSRTLDNDILLIKLFSPAVINSRVSAISLPTAPPAAGTESLISGWGNTLSSGADYPDELQCLDAPVLSQAECEASYPGKITNNMFCVGFLEGGKDSCQGDSGGPVASNGELQGIVSWGYGCAQKNRPGVYTKVYNYVDWI
Specificity
PRSS2 - protease, serine, 2 (trypsin 2),
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
PRSS2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Trypsin 2/PRSS2 Antibody

  • Anionic trypsinogen
  • EC 3.4.21
  • EC 3.4.21.4
  • MGC111183
  • MGC120174
  • MGC120175
  • protease serine 2 preproprotein
  • protease, serine, 2 (trypsin 2)
  • protease, serine, 2, preproprotein
  • PRSS2
  • Serine protease 2
  • Tesp4
  • TRY2TRY8
  • TRY8
  • TRYP2
  • Trypsin 2
  • Trypsin II
  • trypsin-2
  • trypsinogen 2
  • Trypsinogen 20

Background

This gene encodes a trypsinogen, which is a member of the trypsin family of serine proteases. This enzyme is secreted by the pancreas and cleaved to its active form in the small intestine. It is active on peptide linkages involving the carboxyl group of lysine or arginine. This gene and several other trypsinogen genes are localized to the T cell receptor beta locus on chromosome 7. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3848
Species: Hu
Applications: WB, IHC, IP
H00006690-M01
Species: Hu
Applications: WB, ELISA, IHC-P, IP
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBL1-17349
Species: Hu
AF1585
Species: Hu
Applications: WB, IP
AF2898
Species: Mu
Applications: WB, IP
AF3565
Species: Mu
Applications: WB, IHC, IP
NBP1-81259
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-193
Species: Hu, Mu, Rt, Ch, GP
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-79670
Species: Hu
Applications: WB
NBP1-22568
Species: Hu
Applications: IHC-P
AF6907
Species: Hu
Applications: WB, IHC
NBP1-35641
Species: Hu
Applications: WB, IHC, IHC-P
H00005645-B01P
Species: Hu
Applications: WB

Publications for Trypsin 2/PRSS2 Antibody (H00005645-B01P) (0)

There are no publications for Trypsin 2/PRSS2 Antibody (H00005645-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Trypsin 2/PRSS2 Antibody (H00005645-B01P) (0)

There are no reviews for Trypsin 2/PRSS2 Antibody (H00005645-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Trypsin 2/PRSS2 Antibody (H00005645-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Trypsin 2/PRSS2 Products

Bioinformatics Tool for Trypsin 2/PRSS2 Antibody (H00005645-B01P)

Discover related pathways, diseases and genes to Trypsin 2/PRSS2 Antibody (H00005645-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Trypsin 2/PRSS2 Antibody (H00005645-B01P)

Discover more about diseases related to Trypsin 2/PRSS2 Antibody (H00005645-B01P).
 

Pathways for Trypsin 2/PRSS2 Antibody (H00005645-B01P)

View related products by pathway.

PTMs for Trypsin 2/PRSS2 Antibody (H00005645-B01P)

Learn more about PTMs related to Trypsin 2/PRSS2 Antibody (H00005645-B01P).

Blogs on Trypsin 2/PRSS2

There are no specific blogs for Trypsin 2/PRSS2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Trypsin 2/PRSS2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRSS2
Entrez
Uniprot