Recombinant Human TRPC3 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Product Discontinued
View other related TRPC3 Peptides and Proteins

Order Details


    • Catalog Number
      H00007222-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human TRPC3 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 485-535 of Human TRPC3

Source: Wheat Germ (in vitro)

Amino Acid Sequence: TARFLAFLQATKAQQYVDSYVQESDLSEVTLPPEIQYFTYARDKWLPSDPQ

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
TRPC3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
31.35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TRPC3 GST (N-Term) Protein

  • hTrp3
  • hTrp-3
  • short transient receptor potential channel 3
  • transient receptor potential cation channel, subfamily C, member 3
  • transient receptor potential channel 3
  • Transient receptor protein 3
  • TRP3
  • TRP-3
  • TRPC3

Background

The transient receptor potential canonical (TRPC) group of channels, including TPRC3, is a family of receptor-activated non-selective calcium permeant cation channels. In vitro TRPC proteins can form hetero- or homo-oligomeric channels. Endogenous TRPC1, TRPC3 and TRPC7 participate in forming heteromeric store-operated channels, while TRPC3 and TRPC7 can also participate in forming heteromeric receptor-operated channels. TRPC3 plays important roles in neuronal differentiation and immune cell maturation by mediating the cationic current in response to phospholipase C activation, Ca(2+) depletion, and diacylglycerol stimulation. TRPC3 channels are highly expressed in pontine neurons and mediate a nonselective cation current in response to the neurotrophin receptor, TrkB.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77260
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-88370
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-98844
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP2-49671
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-20989
Species: Hu, Rt
Applications: IHC,  IHC-P, PEP-ELISA, WB
NB110-81601
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-12919
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, MiAr, WB
NBP1-48318
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, MiAr, WB
AF2364
Species: Hu
Applications: IHC, WB
NB120-2938
Species: Bv, Hu, Mu
Applications: IHC,  IHC-P, WB
AF6868
Species: Hu
Applications: IHC, KO, WB
NBP1-21398
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
AF2747
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
H00006786-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-80537
Species: Mu
Applications: IHC,  IHC-P, WB
NBP1-48036
Species: Ca, Hu, Pm, Pm
Applications: IHC,  IHC-P, WB
NBP2-12906
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, MiAr, WB
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-15669
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB

Publications for TRPC3 Partial Recombinant Protein (H00007222-Q01) (0)

There are no publications for TRPC3 Partial Recombinant Protein (H00007222-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRPC3 Partial Recombinant Protein (H00007222-Q01) (0)

There are no reviews for TRPC3 Partial Recombinant Protein (H00007222-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TRPC3 Partial Recombinant Protein (H00007222-Q01). (Showing 1 - 1 of 1 FAQ).

  1. I would like to test some of your TRPC3 antibodies in my model system (Xenopus), but they have not been proven to work in this species. Do you offer any guarantee, or beta testing program. We would be happy to send you any images we produce if the antibody works (WB, IHC, ICC). We know that TRPC1-5 are expressed in our system (Xenopus spinal cord).
    • We do offer a testing program, the Innovators Reward Program. Our Innovator’s Reward program is designed to support your innovative research with minimal financial risk to you. Should you decide to use one of our products in an application or species for which it has not been tested all you need to do is submit a full review of the antibody with an image to qualify.

Additional TRPC3 Products

Research Areas for TRPC3 Partial Recombinant Protein (H00007222-Q01)

Find related products by research area.

Blogs on TRPC3

There are no specific blogs for TRPC3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TRPC3 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TRPC3