Recombinant Human TRPC3 GST (N-Term) Protein Summary
| Description |
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 485-535 of Human TRPC3 Source: Wheat Germ (in vitro) Amino Acid Sequence: TARFLAFLQATKAQQYVDSYVQESDLSEVTLPPEIQYFTYARDKWLPSDPQ |
Preparation Method |
in vitro wheat germ expression system |
| Details of Functionality |
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated. |
| Source |
Wheat germ |
| Protein/Peptide Type |
Partial Recombinant Protein |
| Gene |
TRPC3 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunoaffinity Purification
- Protein Array
- Western Blot
|
| Theoretical MW |
31.35 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -80C. Avoid freeze-thaw cycles. |
| Buffer |
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Recombinant Human TRPC3 GST (N-Term) Protein
Background
The transient receptor potential canonical (TRPC) group of channels, including TPRC3, is a family of receptor-activated non-selective calcium permeant cation channels. In vitro TRPC proteins can form hetero- or homo-oligomeric channels. Endogenous TRPC1, TRPC3 and TRPC7 participate in forming heteromeric store-operated channels, while TRPC3 and TRPC7 can also participate in forming heteromeric receptor-operated channels. TRPC3 plays important roles in neuronal differentiation and immune cell maturation by mediating the cationic current in response to phospholipase C activation, Ca(2+) depletion, and diacylglycerol stimulation. TRPC3 channels are highly expressed in pontine neurons and mediate a nonselective cation current in response to the neurotrophin receptor, TrkB.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
Species: Hu
Applications: IHC, WB
Species: Bv, Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, KO, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Mu
Applications: IHC, IHC-P, WB
Species: Ca, Hu, Pm, Pm
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, MiAr, WB
Species: Mu, Rt
Applications: ICC/IF, WB
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
Publications for TRPC3 Partial Recombinant Protein (H00007222-Q01) (0)
There are no publications for TRPC3 Partial Recombinant Protein (H00007222-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for TRPC3 Partial Recombinant Protein (H00007222-Q01) (0)
There are no reviews for TRPC3 Partial Recombinant Protein (H00007222-Q01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for TRPC3 Partial Recombinant Protein (H00007222-Q01). (Showing 1 - 1 of 1 FAQ).
-
I would like to test some of your TRPC3 antibodies in my model system (Xenopus), but they have not been proven to work in this species. Do you offer any guarantee, or beta testing program. We would be happy to send you any images we produce if the antibody works (WB, IHC, ICC). We know that TRPC1-5 are expressed in our system (Xenopus spinal cord).
- We do offer a testing program, the Innovators Reward Program. Our Innovator’s Reward program is designed to support your innovative research with minimal financial risk to you. Should you decide to use one of our products in an application or species for which it has not been tested all you need to do is submit a full review of the antibody with an image to qualify.
Additional TRPC3 Products
Research Areas for TRPC3 Partial Recombinant Protein (H00007222-Q01)
Find related products by research area.
|
Blogs on TRPC3