Recombinant Human TROVE2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human TROVE2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-100 of Human TROVE2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MEESVNQMQPLNEKQIANSQDGYVWQVTDMNRLHRFLCFGSEGGTYYIKEQKLGLENAEALIRLIEDGRGCEVIQEIKSFSQEGRTTKQEPMLFALAICS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
TROVE2
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TROVE2 Protein

  • 60 kDa ribonucleoprotein Ro
  • 60 kDa Ro protein
  • 60 kDa SS-A/Ro ribonucleoprotein
  • Ro 60 kDa autoantigen
  • RO60gastric cancer multi-drug resistance protein
  • RORNP
  • Sjoegren syndrome antigen A2
  • Sjoegren syndrome type A antigen
  • Sjogren syndrome antigen A2 (60kDa, ribonucleoprotein autoantigen SS-A/Ro)
  • SS-A
  • SSA2Sjogren syndrome antigen A2 (60kD, ribonucleoprotein autoantigen SS-A/Ro)
  • TROVE domain family member 2
  • TROVE domain family, member 2

Background

TROVE2 - TROVE domain family, member 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
NBP1-33548
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-48002
Species: Hu, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-57100
Species: Hu
Applications: ICC/IF
NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB500-526
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-31898
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-57487
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
AF1936
Species: Hu
Applications: WB, IP
H00003347-M01
Species: Hu
Applications: ELISA, ICC/IF
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-54435
Species: Hu
Applications: WB, Flow, IP
NBP1-89312
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NBP1-87914
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00006738-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for TROVE2 Partial Recombinant Protein (H00006738-Q01) (0)

There are no publications for TROVE2 Partial Recombinant Protein (H00006738-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TROVE2 Partial Recombinant Protein (H00006738-Q01) (0)

There are no reviews for TROVE2 Partial Recombinant Protein (H00006738-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TROVE2 Partial Recombinant Protein (H00006738-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TROVE2 Products

Bioinformatics Tool for TROVE2 Partial Recombinant Protein (H00006738-Q01)

Discover related pathways, diseases and genes to TROVE2 Partial Recombinant Protein (H00006738-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TROVE2 Partial Recombinant Protein (H00006738-Q01)

Discover more about diseases related to TROVE2 Partial Recombinant Protein (H00006738-Q01).
 

Pathways for TROVE2 Partial Recombinant Protein (H00006738-Q01)

View related products by pathway.

PTMs for TROVE2 Partial Recombinant Protein (H00006738-Q01)

Learn more about PTMs related to TROVE2 Partial Recombinant Protein (H00006738-Q01).

Blogs on TROVE2

There are no specific blogs for TROVE2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

TROVE2 Antibody
NBP1-86998

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TROVE2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TROVE2