Recombinant Human TRIP6 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human TRIP6 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 51-148 of Human TRIP6 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:SEQCYQAPGGPEDRGPAWVGSHGVLQHTQGLPADRGGLRPGSLDAEIDLLSSTLAELNGGRGHASRRPDRQAYEPPPPPAYRTGSLKPNPASPLPASP

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
TRIP6
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TRIP6 Protein

  • MGC10556
  • MGC10558
  • MGC29959
  • MGC3837
  • MGC4423
  • OIP1OIP-1
  • Opa-interacting protein 1
  • thyroid hormone receptor interactor 6
  • thyroid receptor-interacting protein 6
  • TR-interacting protein 6
  • ZRP-1TRIP-6
  • zyxin related protein 1
  • Zyxin-related protein 1

Background

TRIP6 - thyroid hormone receptor interactor 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-36768
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-47516
Species: Hu, Mu, Ha, Mk, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-37477
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP1-84843
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56139
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-45923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP1-80833
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
AF4259
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP1-84841
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-89570
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP

Publications for TRIP6 Partial Recombinant Protein (H00007205-Q02) (0)

There are no publications for TRIP6 Partial Recombinant Protein (H00007205-Q02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRIP6 Partial Recombinant Protein (H00007205-Q02) (0)

There are no reviews for TRIP6 Partial Recombinant Protein (H00007205-Q02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TRIP6 Partial Recombinant Protein (H00007205-Q02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TRIP6 Products

Bioinformatics Tool for TRIP6 Partial Recombinant Protein (H00007205-Q02)

Discover related pathways, diseases and genes to TRIP6 Partial Recombinant Protein (H00007205-Q02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRIP6 Partial Recombinant Protein (H00007205-Q02)

Discover more about diseases related to TRIP6 Partial Recombinant Protein (H00007205-Q02).
 

Pathways for TRIP6 Partial Recombinant Protein (H00007205-Q02)

View related products by pathway.

PTMs for TRIP6 Partial Recombinant Protein (H00007205-Q02)

Learn more about PTMs related to TRIP6 Partial Recombinant Protein (H00007205-Q02).
 

Research Areas for TRIP6 Partial Recombinant Protein (H00007205-Q02)

Find related products by research area.

Blogs on TRIP6

There are no specific blogs for TRIP6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

TRIP6 Antibody
NB100-79791

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TRIP6 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TRIP6