TRIM9 Antibody (1F12)

Images

 
Western Blot: TRIM9 Antibody (1F12) [H00114088-M01] - Analysis of TRIM9 expression in transfected 293T cell line by TRIM9 monoclonal antibody (M01), clone 1F12.Lane 1: TRIM9 transfected lysate(61.3 KDa).Lane 2: ...read more

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, IP
Clone
1F12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TRIM9 Antibody (1F12) Summary

Immunogen
TRIM9 (NP_055978.4, 1 a.a. ~ 109 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MEEMEEELKCPVCGSFYREPIILPCSHNLCQACARNILVQTPESESPQSHRAAGSGVSDYDYLDLDKMSLYSEADSGYGSYGGFASAPTTPCQKSPNGVRVFPPAMPPP
Specificity
TRIM9 - tripartite motif-containing 9
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TRIM9
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA 1:100-1:2000
  • Immunoprecipitation
Application Notes
Antibody reactive against recombinant protein on ELISA. It has also been used for Western Blot.
Publications
Read Publications using H00114088-M01.

Reactivity Notes

Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TRIM9 Antibody (1F12)

  • EC 6.3.2.-
  • KIAA0282homolog of rat RING finger Spring
  • RNF91RING finger protein 91
  • SPRINGE3 ubiquitin-protein ligase TRIM9
  • tripartite motif containing 9
  • tripartite motif-containing 9
  • Tripartite motif-containing protein 9

Background

The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. Its function has not been identified. Alternate splicing of this gene generates two transcript variants encoding different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33714
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-01763
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP1-87035
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4708
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
NB300-595
Species: Mu, Rt, Bv, Pm
Applications: WB, Flow, IHC, IHC-P, IP, IF
NBP1-89679
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
H00051127-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, PLA, S-ELISA
H00022954-M09
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, RNAi, S-ELISA
AF7237
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-26612
Species: Hu
Applications: IP (-), WB
NB100-80870
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, ELISA, IHC, IHC-P
NBP1-55028
Species: Hu
Applications: WB
NBP1-32493
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-24655
Species: Hu, Rt, Pm
Applications: WB, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76601
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB110-60011
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-27152
Species: Mu
Applications: WB
NBP2-02042
Species: Hu
Applications: WB, Flow, ICC/IF
H00114088-M01
Species: Hu, Mu
Applications: WB, ELISA, IP

Publications for TRIM9 Antibody (H00114088-M01)(2)

Reviews for TRIM9 Antibody (H00114088-M01) (0)

There are no reviews for TRIM9 Antibody (H00114088-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TRIM9 Antibody (H00114088-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TRIM9 Products

Bioinformatics Tool for TRIM9 Antibody (H00114088-M01)

Discover related pathways, diseases and genes to TRIM9 Antibody (H00114088-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRIM9 Antibody (H00114088-M01)

Discover more about diseases related to TRIM9 Antibody (H00114088-M01).
 

Pathways for TRIM9 Antibody (H00114088-M01)

View related products by pathway.

Research Areas for TRIM9 Antibody (H00114088-M01)

Find related products by research area.

Blogs on TRIM9

There are no specific blogs for TRIM9, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRIM9 Antibody (1F12) and receive a gift card or discount.

Bioinformatics

Gene Symbol TRIM9
Entrez
OMIM
Uniprot