We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

TRIM72 Recombinant Protein Antigen

Images

 
There are currently no images for TRIM72 Recombinant Protein Antigen (NBP2-49157PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TRIM72 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TRIM72.

Source: E. coli

Amino Acid Sequence: LEAHVEAKEPRALRSPERRPTRIGLYLSFGDGVLSFYDASDADALVPLFAFHERLPRPVYPFFDVCWHDKGKNAQPLLLVGPE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TRIM72
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49157.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TRIM72 Recombinant Protein Antigen

  • MG53Mg53
  • Mitsugumin-53
  • tripartite motif containing 72
  • tripartite motif-containing 72
  • tripartite motif-containing protein 72

Background

Muscle-specific protein that plays a central role in cell membrane repair by nucleating the assembly of therepair machinery at injury sites. Specifically binds phosphatidylserine. Acts as a sensor of oxidation: upon membranedamage, entry of extracellular oxidative environment results in disulfide bond formation and homooligomerization atthe injury site. This oligomerization acts as a nucleation site for recruitment of TRIM72-containing vesicles to theinjury site, leading to membrane patch formation. Probably acts upstream of the Ca(2+)-dependent membrane resealingprocess. Required for transport of DYSF to sites of cell injury during repair patch formation. Regulates membranebudding and exocytosis. May be involved in the regulation of the mobility of KCNB1-containing endocytic vesicles (Bysimilarity)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-5029
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP3-07994
Species: Hu
Applications: IHC,  IHC-P, WB
AF4708
Species: Hu
Applications: CyTOF-ready, ICFlow, Simple Western, WB
NBP2-81038
Species: Bv, Hu, Po, Sh
Applications: ELISA, Flow, ICC/IF, IHC, IP, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
H00051127-M01
Species: Hu
Applications: ELISA, ICC/IF, PLA, S-ELISA, WB
H00004205-M15
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP3-05061
Species: Hu, Mu
Applications: ICC/IF, WB
NBP2-38498
Species: Hu
Applications: IHC,  IHC-P
NBP1-80220
Species: Hu, Mu
Applications: IHC,  IHC-P, KO, WB
NB100-56511
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, KO, WB
NB100-82001
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
MAB66861
Species: Hu
Applications: ICC, WB
NBP1-88650
Species: Hu
Applications:  IHC-P, KD, WB
NBP3-35070
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-49157PEP
Species: Hu
Applications: AC

Publications for TRIM72 Recombinant Protein Antigen (NBP2-49157PEP) (0)

There are no publications for TRIM72 Recombinant Protein Antigen (NBP2-49157PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRIM72 Recombinant Protein Antigen (NBP2-49157PEP) (0)

There are no reviews for TRIM72 Recombinant Protein Antigen (NBP2-49157PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TRIM72 Recombinant Protein Antigen (NBP2-49157PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TRIM72 Products

Research Areas for TRIM72 Recombinant Protein Antigen (NBP2-49157PEP)

Find related products by research area.

Blogs on TRIM72

There are no specific blogs for TRIM72, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TRIM72 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TRIM72