TRIM59 Antibody

Images

 
Western Blot: TRIM59 Antibody [NBP1-82625] - Analysis in human cell line NTERA-2.
Immunohistochemistry-Paraffin: TRIM59 Antibody [NBP1-82625] - Staining of human corpus, uterine shows cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TRIM59 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MHNFEEELTCPICYSIFEDPRVLPCSHTFCRNCLENILQASGNFYIWRPLRIPLKCPNCRSITEIAPTGIESLPVNFALRAIIEKYQQEDHPDIVTCPEHYRQPLNVYCLL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRIM59
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Theoretical MW
47 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
TRIM59 Protein (NBP1-82625PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TRIM59 Antibody

  • MGC129860
  • MGC129861
  • Mrf1
  • RING finger protein 104
  • RNF104MGC26631
  • TRIM57
  • tripartite motif containing 59
  • tripartite motif-containing 57
  • tripartite motif-containing 59
  • tripartite motif-containing protein 59
  • TSBF1MRF1
  • tumor suppressor TSBF1
  • Tumor suppressor TSBF-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81037
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86380
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-81021
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
MAB8175
Species: Hu
Applications: WB, Simple Western, IHC
H00009617-B01P
Species: Hu
Applications: WB, ELISA
NBP1-31113
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88667
Species: Hu
Applications: IHC, IHC-P
AF3075
Species: Hu
Applications: WB, ICC
NBP1-82853
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NB100-2600
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
AF3760
Species: Hu
Applications: WB
1341-WF/CF
Species: Hu
NB600-844
Species: Hu, Mu, Rt, Ch, Rb
Applications: WB, IHC, IHC-Fr, IHC-P, IF
NBP1-85657
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF5059
Species: Hu
Applications: WB, IHC
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC

Publications for TRIM59 Antibody (NBP1-82625) (0)

There are no publications for TRIM59 Antibody (NBP1-82625).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRIM59 Antibody (NBP1-82625) (0)

There are no reviews for TRIM59 Antibody (NBP1-82625). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TRIM59 Antibody (NBP1-82625) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TRIM59 Products

Bioinformatics Tool for TRIM59 Antibody (NBP1-82625)

Discover related pathways, diseases and genes to TRIM59 Antibody (NBP1-82625). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRIM59 Antibody (NBP1-82625)

Discover more about diseases related to TRIM59 Antibody (NBP1-82625).
 

Pathways for TRIM59 Antibody (NBP1-82625)

View related products by pathway.

PTMs for TRIM59 Antibody (NBP1-82625)

Learn more about PTMs related to TRIM59 Antibody (NBP1-82625).

Blogs on TRIM59

There are no specific blogs for TRIM59, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRIM59 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRIM59
Entrez
Uniprot