Recombinant Human TRIM5 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human TRIM5 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 309 - 418 of Human TRIM5 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:SCAVISEDKRQVSSPKPQIIYGARGTRYQTFVNFNYCTGILGSQSITSGKHYWEVDVSKKTAWILGVCAGFQPDAMCNIEKNENYQPKYGYWVIGLEEGVKCSAFQDSSF

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
TRIM5
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TRIM5 Protein

  • EC 6.3.2
  • EC 6.3.2.-
  • RING finger protein 88
  • RNF88
  • RNF88tripartite motif protein TRIM
  • TRIM5
  • TRIM5alpha
  • tripartite motif containing 5
  • tripartite motif protein TRIM5
  • tripartite motif-containing 5
  • tripartite motif-containing protein 5

Background

TRIM5 - tripartite motif-containing 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3589
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
AF4708
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
AF3589
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP2-53089
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-116
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
DDX0390P-100
Species: Mu
Applications: B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vivo
NBP1-57516
Species: Hu
Applications: WB
NBP2-39019
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33548
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
MAB2545
Species: Hu
Applications: WB, IHC, IP
NB100-59787
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP, PLA
NB110-40561
Species: Hu
Applications: WB, IP
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
MAB182
Species: Hu
Applications: Flow, CyTOF-ready, ICC, Neut
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
H00085363-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for TRIM5 Partial Recombinant Protein (H00085363-Q01) (0)

There are no publications for TRIM5 Partial Recombinant Protein (H00085363-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRIM5 Partial Recombinant Protein (H00085363-Q01) (0)

There are no reviews for TRIM5 Partial Recombinant Protein (H00085363-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TRIM5 Partial Recombinant Protein (H00085363-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TRIM5 Products

Bioinformatics Tool for TRIM5 Partial Recombinant Protein (H00085363-Q01)

Discover related pathways, diseases and genes to TRIM5 Partial Recombinant Protein (H00085363-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRIM5 Partial Recombinant Protein (H00085363-Q01)

Discover more about diseases related to TRIM5 Partial Recombinant Protein (H00085363-Q01).
 

Pathways for TRIM5 Partial Recombinant Protein (H00085363-Q01)

View related products by pathway.

PTMs for TRIM5 Partial Recombinant Protein (H00085363-Q01)

Learn more about PTMs related to TRIM5 Partial Recombinant Protein (H00085363-Q01).
 

Research Areas for TRIM5 Partial Recombinant Protein (H00085363-Q01)

Find related products by research area.

Blogs on TRIM5

There are no specific blogs for TRIM5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

TRIM5 Antibody
NB100-1226

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TRIM5 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TRIM5
Entrez