TRIM41 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

TRIM41 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TRIM41.
  
  

  Source: E. coli

  Amino Acid Sequence: RESTHHKEKVGPGGSSVGSGDASSSRHHHRRRRLHLPQQPLLQREVWCVGTNGKRYQAQSSTEQTLLSPSEKPRRFGVYLDYEA

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: TRIM41
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-81227.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 27 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TRIM41 Recombinant Protein Antigen

• tripartite motif containing 41

Background

Tripartite motif containing protein 41 or E3 ubiquitin-protein ligase TRIM41 (human TRIM41 theoretical molecular weight 72 kDa) is a RING finger domain protein which catalyzes the degradation of protein kinase C (PKC). TRIM family members share N-terminal RING finger, one or two B box, and Coiled-Coil domains (CCD). The RING (Really Interesting New Gene) finger domain imparts TRIMs with E3 ubiquitin ligase activity and ability to regulate cell cycle, transcription factor, and signal transducing genes. TRIMs are involved in different cellular processes including cellular differentiation, senescence, stem cell pluripotency, and control of microbial infections (1). TRIM41 plays a role in the regulation of innate immunity to viral infections. Hepatitis B virus (HBV) replication is inhibited by TRIM41 in a process dependent on its E3 ligase activity (2, 3). TRIM41 is also involved in the inhibition of influenza A virus (IAV) by ubiquitinating and targeting the influenza nucleoprotein for proteasome degradation (4).

1. Kimura, T., Mandell, M., & Deretic, V. (2016). Precision autophagy directed by receptor regulators - emerging examples within the TRIM family. Journal of Cell Science. https://doi.org/10.1242/jcs.163758

2. Kong, F., You, H., Kong, D., Zheng, K., & Tang, R. (2019). The interaction of hepatitis B virus with the ubiquitin proteasome system in viral replication and associated pathogenesis. Virology Journal. https://doi.org/10.1186/s12985-019-1183-z

3. van Tol, S., Hage, A., Giraldo, M. I., Bharaj, P., & Rajsbaum, R. (2017). The TRIMendous role of TRIMs in virus-host interactions. Vaccines. https://doi.org/10.3390/vaccines5030023

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: TRIM41