Trim11 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Trim11 Antibody [NBP1-88609] - Staining of human cell line A-431 shows localization to nucleus & cytosol. Antibody staining is shown in green.

Analysis in human cell line BEWO.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Trim11 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Trim11 Antibody - BSA Free (NBP1-88609) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LGQQSAHLAELIAELEGRCQLPALGLLQDIKDALRRVQDVKLQPPEVVPMELRTVCRVPGLVETLRRFRGDVTLDP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TRIM11
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Trim11 Protein (NBP1-88609PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (88%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Trim11 Antibody - BSA Free

• BIA1
• EC 6.3.2.-
• Protein BIA1
• RING finger protein 92
• RNF92
• RNF92E3 ubiquitin-protein ligase TRIM11
• TRIM11
• tripartite motif containing 11
• tripartite motif-containing 11
• Tripartite motif-containing protein 11

Background

Trim11 is encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein localizes to the nucleus and the cytoplasm. Its function has not been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TRIM11