Trim11 Antibody

Images

 
Western Blot: Trim11 Antibody [NBP1-88609] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: Trim11 Antibody [NBP1-88609] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus & cytosol.
Immunohistochemistry-Paraffin: Trim11 Antibody [NBP1-88609] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.
Immunocytochemistry/ Immunofluorescence: Trim11 Antibody [NBP1-88609] - Staining of human cell line U-2 OS shows positivity in cytoplasm.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Trim11 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LGQQSAHLAELIAELEGRCQLPALGLLQDIKDALRRVQDVKLQPPEVVPMELRTVCRVPGLVETLRRFRGDVTLDP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRIM11
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Trim11 Protein (NBP1-88609PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%), Rat (84%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Trim11 Antibody

  • BIA1
  • EC 6.3.2.-
  • Protein BIA1
  • RING finger protein 92
  • RNF92E3 ubiquitin-protein ligase TRIM11
  • tripartite motif containing 11
  • tripartite motif-containing 11
  • Tripartite motif-containing protein 11

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4708
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
NBP2-49156
Species: Hu
Applications: ICC/IF, IHC
NBP1-89018
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4940
Species: Hu, Mu
Applications: ICC
AF877
Species: Hu
Applications: WB, IHC, IP
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85439
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31386
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB300-750
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP1-59068
Species: Hu
Applications: WB
H00011155-M06
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-25147
Species: Hu, Mu, Rt, Bv, Xp
Applications: WB, Simple Western, ICC/IF
NBP1-84212
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB1233
Species: Hu
Applications: Flow, IP, CyTOF-ready, ICC

Publications for Trim11 Antibody (NBP1-88609) (0)

There are no publications for Trim11 Antibody (NBP1-88609).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Trim11 Antibody (NBP1-88609) (0)

There are no reviews for Trim11 Antibody (NBP1-88609). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Trim11 Antibody (NBP1-88609) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Trim11 Products

Bioinformatics Tool for Trim11 Antibody (NBP1-88609)

Discover related pathways, diseases and genes to Trim11 Antibody (NBP1-88609). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Trim11 Antibody (NBP1-88609)

Discover more about diseases related to Trim11 Antibody (NBP1-88609).
 

Pathways for Trim11 Antibody (NBP1-88609)

View related products by pathway.

PTMs for Trim11 Antibody (NBP1-88609)

Learn more about PTMs related to Trim11 Antibody (NBP1-88609).

Blogs on Trim11

There are no specific blogs for Trim11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Trim11 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRIM11