Treacher Collins syndrome protein Antibody (8H3) - Azide and BSA Free

Western Blot: Treacher Collins syndrome protein Antibody (8H3) [H00006949-M02] - Analysis of TCOF1 expression in transfected 293T cell line by TCOF1 monoclonal antibody (M02), clone 8H3.Lane 1: TCOF1 transfected lysate(152.104 KDa).Lane 2: Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: Treacher Collins syndrome protein Antibody (8H3) [H00006949-M02] - Analysis of monoclonal antibody to TCOF1 on HeLa cell . Antibody concentration 10 ug/ml.

ELISA: Treacher Collins syndrome protein Antibody (8H3) [H00006949-M02] - Detection limit for recombinant GST tagged TCOF1 is 0.3 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF
• Clone: 8H3
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Treacher Collins syndrome protein Antibody (8H3) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: TCOF1 (NP_001008657, 2 a.a. ~ 82 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AEARKRRELLPLIYHHLLRAGYVRAAREVKEQSGQKCFLAQPVTLLDIYTHWQQTSELGRKRKAEEDAALQAKKTRVSDPI
• Localization: Nucleus, nucleolus.
• Specificity: TCOF1 - Treacher Collins-Franceschetti syndrome 1
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: TCOF1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
• Application Notes: Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Treacher Collins syndrome protein Antibody (8H3) - Azide and BSA Free

• MFD1
• nucleolar trafficking phosphoprotein
• TCS1
• Treacher Collins syndrome protein
• Treacher Collins-Franceschetti syndrome 1
• treacle protein
• treacle

Background

This gene encodes a nucleolar protein with a LIS1 homology domain. The protein is involved in ribosomal DNA gene transcription through its interaction with upstream binding factor (UBF). Mutations in this gene have been associated with Treacher Collins syndrome, a disorder which includes abnormal craniofacial development. Alternate transcriptional splice variants encoding different isoforms have been found for this gene, but only three of them have been characterized to date.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TCOF1
• Entrez:
  • 6949(Human)
• OMIM:
  • 154500(Human)
• Uniprot:
  • NP_001008657(Human)