Trappin-2/Elafin/Skalp Antibody (2G20)

Images

 
Western Blot: Trappin-2/Elafin/Skalp Antibody (2G20) [H00005266-M02] - Analysis of PI3 expression in transfected 293T cell line by PI3 monoclonal antibody (M02), clone 2G20.Lane 1: PI3 transfected lysate (Predicted MW: ...read more
Immunoprecipitation: Trappin-2/Elafin/Skalp Antibody (2G20) [H00005266-M02] - Analysis of PI3 transfected lysate using anti-PI3 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PI3 monoclonal ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IP
Clone
2G20
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Trappin-2/Elafin/Skalp Antibody (2G20) Summary

Immunogen
PI3 (AAH10952, 1 a.a. - 117 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MRASSFLIVVVFLIAGTLVLEAAVTGVPVKGQDTVKGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PI3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunoprecipitation
Application Notes
It has been used for ELISA, WB and IP.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Trappin-2/Elafin/Skalp Antibody (2G20)

  • cementoin
  • Elafin
  • Elastase-specific inhibitor
  • ESI
  • ESIWAP four-disulfide core domain protein 14
  • Peptidase inhibitor 3
  • peptidase inhibitor 3, skin-derived
  • PI3
  • PI-3
  • pre-elafin
  • protease inhibitor 3, skin-derived (SKALP)
  • Protease inhibitor WAP3
  • SKALP
  • SKALPELAFIN
  • Skin-derived antileukoproteinase
  • Trappin2
  • Trappin-2
  • WAP four-disulfide core domain 14
  • WAP3MGC13613
  • WFDC14elafin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-46403
Species: Hu
Applications: IHC
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46404
Species: Hu
Applications: IHC, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
H00005266-M02
Species: Hu
Applications: WB, ELISA, IP

Publications for Trappin-2/Elafin/Skalp Antibody (H00005266-M02) (0)

There are no publications for Trappin-2/Elafin/Skalp Antibody (H00005266-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Trappin-2/Elafin/Skalp Antibody (H00005266-M02) (0)

There are no reviews for Trappin-2/Elafin/Skalp Antibody (H00005266-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Trappin-2/Elafin/Skalp Antibody (H00005266-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Trappin-2/Elafin/Skalp Products

Bioinformatics Tool for Trappin-2/Elafin/Skalp Antibody (H00005266-M02)

Discover related pathways, diseases and genes to Trappin-2/Elafin/Skalp Antibody (H00005266-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Trappin-2/Elafin/Skalp Antibody (H00005266-M02)

Discover more about diseases related to Trappin-2/Elafin/Skalp Antibody (H00005266-M02).
 

Pathways for Trappin-2/Elafin/Skalp Antibody (H00005266-M02)

View related products by pathway.

PTMs for Trappin-2/Elafin/Skalp Antibody (H00005266-M02)

Learn more about PTMs related to Trappin-2/Elafin/Skalp Antibody (H00005266-M02).

Blogs on Trappin-2/Elafin/Skalp

There are no specific blogs for Trappin-2/Elafin/Skalp, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Trappin-2/Elafin/Skalp Antibody (2G20) and receive a gift card or discount.

Bioinformatics

Gene Symbol PI3
Entrez
Uniprot