![Immunohistochemistry-Paraffin: TRAPPC6A Antibody [NBP1-83167] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.](http://images.novusbio.com/fullsize/TRAPPC6A-Antibody-Immunohistochemistry-Paraffin-NBP1-83167-img0010.jpg "Immunohistochemistry-Paraffin: TRAPPC6A Antibody [NBP1-83167] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit TRAPPC6A Antibody - BSA Free (NBP1-83167) is a polyclonal antibody validated for use in IHC. Anti-TRAPPC6A Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VGQALGERLPRETLAFREELDVLKFLCKDLWVAVFQKQMDSLR |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TRAPPC6A |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | HIER pH6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
| Publication using NBP1-83167 | Applications | Species |
|---|---|---|
| Williams JL, Cavus O, Loccoh EC et al. Defining the molecular signatures of human right heart failure. Life Sci 2018-03-01 [PMID: 29366750] (Human) | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for TRAPPC6A Antibody (NBP1-83167)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot STAT2 Antibody [Unconjugated]](https://images.novusbio.com/images2/STAT2_PAFST2_Western_Blot_21973.jpg)
![Knockout Validated STAT2 Antibody [Unconjugated]](https://images.novusbio.com/images2/STAT2_PAFST2_Knockout_Validated_21974.jpg)
![Western Blot STAT2 Antibody [Unconjugated]](https://images.novusbio.com/images/paf-st2_human-stat2-affinity-purified-polyclonal-ab-western-blot-12122025854110.jpg)
![Simple Western Thrombospondin-4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Thrombospondin4_AF2390_Simple_Western_16991.jpg)
![Western Blot Thrombospondin-4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Thrombospondin-4_AF2390_Western_Blot_11766.jpg)
![Immunocytochemistry/ Immunofluorescence Thrombospondin-4 Antibody [Unconjugated]](https://images.novusbio.com/images/af2390_human-thrombospondin-4-affinity-purified-polyclonal-ab-41202412403583.jpg)
![N/A CXCL7/NAP-2 [Biotin]](https://images.novusbio.com/images2/DATA_CXCL7_DY393_ELISA_1991.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")