TRAPPC6A Antibody

Images

 
Immunohistochemistry-Paraffin: TRAPPC6A Antibody [NBP1-83167] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TRAPPC6A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VGQALGERLPRETLAFREELDVLKFLCKDLWVAVFQKQMDSLR
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRAPPC6A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
HIER pH6 retrieval is recommended.
Control Peptide
TRAPPC6A Protein (NBP1-83167PEP)
Publications
Read Publication using NBP1-83167.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TRAPPC6A Antibody

  • HSPC289
  • MGC2650
  • trafficking protein particle complex 6A
  • trafficking protein particle complex subunit 6A
  • TRAPP complex subunit 6A
  • TRAPPC6Adelta29-42
  • TRS33

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88664
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-55735
Species: Hu, Mu, Bv, Ca, Ch, Pm
Applications: WB, ICC/IF, IP
MAB2890
Species: Hu
Applications: WB, Simple Western, Flow
NBP2-88319
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-91821
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-90286
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38161
Species: Hu
Applications: IHC, IHC-P
NBP2-33609
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB100-619
Species: Hu
Applications: WB, IHC, IHC-P, IP
H00004999-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
AF5520
Species: Hu, Mu
Applications: WB
NBP1-87411
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for TRAPPC6A Antibody (NBP1-83167)(1)

We have publications tested in 1 confirmed species: Human.


Filter By Application
All Applications
Filter By Species
Human
(1)
All Species

Reviews for TRAPPC6A Antibody (NBP1-83167) (0)

There are no reviews for TRAPPC6A Antibody (NBP1-83167). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TRAPPC6A Antibody (NBP1-83167) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TRAPPC6A Products

Bioinformatics Tool for TRAPPC6A Antibody (NBP1-83167)

Discover related pathways, diseases and genes to TRAPPC6A Antibody (NBP1-83167). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRAPPC6A Antibody (NBP1-83167)

Discover more about diseases related to TRAPPC6A Antibody (NBP1-83167).
 

Pathways for TRAPPC6A Antibody (NBP1-83167)

View related products by pathway.

Blogs on TRAPPC6A

There are no specific blogs for TRAPPC6A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRAPPC6A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRAPPC6A
Uniprot