TRAPPC3 Antibody

Images

 
Western Blot: TRAPPC3 Antibody [NBP1-88664] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunocytochemistry/ Immunofluorescence: TRAPPC3 Antibody [NBP1-88664] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol & the Golgi apparatus.
Immunohistochemistry-Paraffin: TRAPPC3 Antibody [NBP1-88664] - Staining of human prostate shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TRAPPC3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PDNHSSLIYSNLLCGVLRGALEMVQMAVEAKFVQDTLKGDGVTEIRMRFIRRIEDNLPAGE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRAPPC3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TRAPPC3 Protein (NBP1-88664PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TRAPPC3 Antibody

  • 1110058K12Rik
  • BET3BET3 homolog
  • trafficking protein particle complex 3
  • trafficking protein particle complex subunit 3,1110058K12Rik

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-56481
Species: Hu
Applications: ICC/IF
NBP1-55113
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-13478
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB90551
Species: Hu, Mu, Rt
Applications: WB
NB100-98811
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-83167
Species: Hu
Applications: WB, IHC, IHC-P
NBL1-07969
Species: Hu
NBP2-38401
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-55735
Species: Hu, Mu, Bv, Ca, Ch, Pm
Applications: WB, ICC/IF, IP
H00060684-P01
Species: Hu
Applications: WB
NBP1-90286
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32493
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-31649
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-98813
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-23603
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00051112-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IF

Publications for TRAPPC3 Antibody (NBP1-88664) (0)

There are no publications for TRAPPC3 Antibody (NBP1-88664).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRAPPC3 Antibody (NBP1-88664) (0)

There are no reviews for TRAPPC3 Antibody (NBP1-88664). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TRAPPC3 Antibody (NBP1-88664) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TRAPPC3 Products

Bioinformatics Tool for TRAPPC3 Antibody (NBP1-88664)

Discover related pathways, diseases and genes to TRAPPC3 Antibody (NBP1-88664). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRAPPC3 Antibody (NBP1-88664)

Discover more about diseases related to TRAPPC3 Antibody (NBP1-88664).
 

Pathways for TRAPPC3 Antibody (NBP1-88664)

View related products by pathway.

PTMs for TRAPPC3 Antibody (NBP1-88664)

Learn more about PTMs related to TRAPPC3 Antibody (NBP1-88664).

Blogs on TRAPPC3

There are no specific blogs for TRAPPC3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRAPPC3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRAPPC3