Home » TRAP alpha » TRAP alpha Proteins » TRAP alpha Recombinant Protein Antigen

TRAP alpha Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for TRAP alpha Protein (NBP1-86912PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

TRAP alpha Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SSR1.

Source: E.coli

Amino Acid Sequence: ESRKRKRPIQKVEMGTSSQNDVDMSWIPQETLNQINKASPRRLPRKRAQKRSVGSDE
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SSR1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-86912.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for TRAP alpha Recombinant Protein Antigen

  • DKFZp781N23103
  • FLJ14232
  • FLJ22100
  • FLJ23034
  • FLJ78242
  • FLJ93042
  • signal sequence receptor, alpha
  • SSR alpha subunit
  • SSR-alpha
  • translocon-associated protein alpha subunit
  • translocon-associated protein subunit alpha
  • TRAP alpha
  • TRAP-alpha
  • TRAPASignal sequence receptor subunit alpha

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

SSR2 Antibody
NBP1-69471
Western Blot: SSR2 Antibody [NBP1-69471] - This Anti-SSR2 antibody was used in Western Blot of Jurkat tissue lysate at a concentration of 1.25ug/ml.
Immunohistochemistry: SSR2 Antibody [NBP1-69471] - Staining of human Muscle.
(1 Review)
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P
VEGF [HRP]
DVE00
(26 Reviews)
(515 Publications)
Species: Hu
SNRPB Antibody
NBP1-32174
Western Blot: SNRPB Antibody [NBP1-32174] - Sample (30 ug of whole cell lysate) A: HeLa nucleus 12% SDS PAGE; antibody diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: SNRPB Antibody [NBP1-32174] - Paraformaldehyde-fixed HeLa, using SNRPB antibody (Green) at 1:500 dilution. Alpha-tubulin filaments were labeled with an alpha Tubulin antibody (Red) at 1:2000.
Species: Hu
Applications: WB, ICC/IF
Bim Antibody
NBP1-76963
Western Blot: Bim Antibody [NBP1-76963] - Independent Antibody Validation (IAV) via Protein Expression Profile in Cell LinesLoading: 15 ug of lysates per lane.Antibodies: BIM NBP1-76963, (0.5 ug/mL), BIM NBP1-77118, (5 ug/mL), beta-actin (1 ug/mL) and GAPDH (0.02 ug/mL), 1h incubation at RT in 5% NFDM/TBST.Secondary: Goat anti-rabbit IgG HRP conjugate at 1:10000 dilution.
Immunohistochemistry-Paraffin: Bim Antibody [NBP1-76963] - Human skin cancer cells with Bim antibody at 20 ug/ml.
Western Blot: Bim Antibody [NBP1-76963] - Western Blot Validation in Rat Myeloma Cell line:Loading: 15 ug of rat myeloma YB2/0 cell lysate per lane.Antibodies: BIM NBP1-76963, (0.5 ug/mL), 1h incubation at RT in 5% NFDM/TBST.Secondary: Goat anti-rabbit IgG HRP conjugate.
(7 Publications)
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
IL-6 [HRP]
D6050
(26 Reviews)
(474 Publications)
Species: Hu
Catalase Antibody
NBP2-24916
Western Blot: Catalase Antibody [NBP2-24916] - Analysis in liver lysate of 1) human 2) mouse and 3) rat at 0.1 ug/ml.
Immunohistochemistry-Paraffin: Catalase Antibody [NBP2-24916] - Staining of human liver tissue using an isotype control (top) and this antibody (bottom) at 5 ug/ml.
(1 Review)
(7 Publications)
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Influenza A H5N1
Antibody (2B7)
NBP2-22605
Western Blot: Influenza A H5N1 Antibody (2B7) [NBP2-22605] - Recombinant protein (50ng) were resolved by SDS-PAGE, transferred to PVDF membrane and probed with anti-Influenza A H5N1/HA1 antibody (1:3000). Proteins were visualized using a goat anti-mouse secondary antibody conjugated to HRP and an ECL detection system.Lane 1.: H7N9-HA1(19-339aa) (A/Anhui/1-BALF_RG45/2013)Lane 2.: H7N9-HA1(1-523aa)(A/Shanghai/JS01/2013)Lane 3.: H5N1-HA1(17-338aa) (A/Vietnam/HN31242/2007)
Western Blot: Influenza A H5N1 Antibody (2B7) [NBP2-22605] - H5N1/HA1 recombinant protein (50ng) were resolved by SDS-PAGE, transferred to PVDF membrane and probed with anti-human H5N1/HA1 antibody (1:3000). Proteins were visualized using a goat anti-mouse secondary antibody conjugated to HRP and an ECL detection system.
ELISA: Influenza A H5N1 Antibody (2B7) [NBP2-22605] - Analysis using ELISA.
Species: V, V-Vi
Applications: WB, ELISA
Calcium Channel
Flower Homolog Antibo
NBP1-84307
Western Blot: Calcium Channel Flower Homolog Antibody [NBP1-84307] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY413631)
Immunocytochemistry/Immunofluorescence: Calcium Channel Flower Homolog Antibody [NBP1-84307] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli. Antibody staining is shown in green.
Species: Hu
Applications: WB, ICC/IF
HSP10/EPF Antibody
AF3298
Western blot shows lysates of Jurkat human acute T cell leukemia cell line, A431 human epithelial carcinoma cell line, and Neuro-2A mouse neuroblastoma cell line. PVDF membrane was probed with 1 µg/mL Human/Mouse HSP10/EPF Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3298) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band for HSP10/EPF was detected at approximately ??? kDa (as indicated). This experiment was conducted using Immunoblot Buffer Group 4.
(1 Publication)
Species: Hu, Mu
Applications: WB
eNOS Antibody
NB300-500
Immunohistochemistry-Paraffin: eNOS Antibody [NB300-500] - Expression of endothelial markers indicate functional endothelium in TEVG. Whole mount staining of native aorta and TEVG. VE-cadherin is a marker of cellular borders of endothelial cells (green). Endothelial nitric oxide synthase (eNOS) is a marker of a functional endothelium (red). DAPI is a nuclear stain (blue). Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0120328), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: eNOS Antibody [NB300-500] - Staining of eNOS in human lung tissue.
Immunohistochemistry-Paraffin: eNOS Antibody [NB300-500] - Mouse Carotid Artery stained with eNOS antibody. Image from verified customer review.
(3 Reviews)
(17 Publications)
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr, Sh
Applications: WB, IHC, IHC-Fr, IHC-P
MDR1/ABCB1 Antibody
NB100-80870
Western Blot: MDR1/ABCB1 Antibody [NB100-80870] - Analyis of anti-ABCB1 antibody shows detection of ABCB1 in crude membrane extracts from HF insect cells over-expressing human ABCB1. The extract was loaded onto a gel in the amounts indicated followed by electrophoresis and transfer to nitrocellulose. The membrane was probed with the primary antibody diluted to 1:600, followed by Peroxidase Conjugated Affinity Purified Anti-RABBIT IgG at 1:10000. Personal Communication, Anna Calcagno, CCR-NCI, Bethesda, MD.
Immunohistochemistry-Paraffin: MDR1/ABCB1 Antibody [NB100-80870] - Staining of human kidney tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, ELISA, IHC, IHC-P

beta-Galactosidase-1/G ...
NBP2-45731
Western Blot: beta-Galactosidase-1/GLB1 Antibody (OTI1C9) [NBP2-45731] - Analysis of extracts (35ug) from 9 different cell lines by using anti-GLB1 monoclonal antibody (HepG2: human; HeLa: human; SVT2: mouse; A549: human; COS7: monkey; Jurkat: human; MDCK: canine; PC12: rat; MCF7: human).
Immunohistochemistry: beta-Galactosidase-1/GLB1 Antibody (1C9) [NBP2-45731] - Analysis of Adenocarcinoma of Human ovary tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Western Blot: beta-Galactosidase-1/GLB1 Antibody (OTI1C9) [NBP2-45731] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY GLB1.
(5 Publications)
Species: Hu, Ca, Pm
Applications: WB, IHC, IHC-P
IL-4 [Unconjugated]
6507-IL/CF
IL-4 [Unconjugated]
(3 Publications)
Species: Hu
GNPDA1 Antibody
NBP2-24653
Western Blot: GNPDA1 Antibody [NBP2-24653] - analysis of GNPDA1 in human spleen lysate in the 1) absence and 2) presence of immunizing peptide 3) mouse spleen and 4) rat spleen using GNPDA1 antibody at 1.0 ug/ml, 0.5 ug/ml and 0.5 ug/ml, respectively.
Immunohistochemistry-Paraffin: GNPDA1 Antibody [NBP2-24653] - Formalin-fixed paraffin-embedded human kidney tissue stained with GNPDA1 antibody at 10 ug/ml. Staining of formalin-fixed tissues is enhanced by boiling tissue sections in 10 mM sodium citrate buffer, pH 6.0 for 10-20 min followed by cooling at RT for 20 min.
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
CD55/DAF Antibody
NBP1-85466
Immunohistochemistry-Paraffin: CD55/DAF Antibody [NBP1-85466] - Staining in human lung and kidney tissues using anti-CD55 antibody. Corresponding CD55 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: CD55/DAF Antibody [NBP1-85466] - Staining of human kidney shows low expression as expected.
Immunohistochemistry-Paraffin: CD55/DAF Antibody [NBP1-85466] - Staining of human lung shows high expression.
(2 Publications)
Species: Hu, Mu, Fe
Applications: WB, IHC, IHC-P
Calretinin Antibody
NBP1-88220
Immunohistochemistry-Paraffin: Calretinin Antibody [NBP1-88220] - Staining in human testis and skeletal muscle tissues using NBP1-88220 antibody. Corresponding CALB2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Calretinin Antibody [NBP1-88220] - Staining of human cerebellum, skeletal muscle, stomach and testis using Anti-CALB2 antibody NBP1-88220 (A) shows similar protein distribution across tissues to independent antibody NBP1-88221 (B).
Western Blot: Calretinin Antibody [NBP1-88220] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. Loading control: Anti-PPIB.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD

Publications for TRAP alpha Protein (NBP1-86912PEP) (0)

There are no publications for TRAP alpha Protein (NBP1-86912PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRAP alpha Protein (NBP1-86912PEP) (0)

There are no reviews for TRAP alpha Protein (NBP1-86912PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TRAP alpha Protein (NBP1-86912PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Learn about Custom Antibody Labeling

Additional TRAP alpha Products

Bioinformatics Tool for TRAP alpha Protein (NBP1-86912PEP)

Discover related pathways, diseases and genes to TRAP alpha Protein (NBP1-86912PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRAP alpha Protein (NBP1-86912PEP)

Discover more about diseases related to TRAP alpha Protein (NBP1-86912PEP).
 

Pathways for TRAP alpha Protein (NBP1-86912PEP)

View related products by pathway.

Research Areas for TRAP alpha Protein (NBP1-86912PEP)

Find related products by research area.

Blogs on TRAP alpha

There are no specific blogs for TRAP alpha, but you can read our latest blog posts.

Customers Who Bought This Also Bought

VEGF [HRP]
VEGF [HRP]
DVE00

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TRAP alpha Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol SSR1