Transgelin/TAGLN/SM22 alpha Antibody - BSA Free

Staining of human breast shows cytoplasmic positivity in myoepithelial cells.

Analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Transgelin/TAGLN/SM22 alpha Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Transgelin/TAGLN/SM22 alpha Antibody - BSA Free (NBP3-25205) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein Transgelin/TAGLN/SM22 alpha using the following amino acid sequence: KNDGHYRGDPNWFMKKAQEHKREFTESQLQ
• Predicted Species: Mouse (90%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TAGLN
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 µg/ml
• Application Notes: For IHC-Paraffin, we recommend using Heat-Induced Epitope Retrieval (HIER) with a pH level of 6. This optimized retrieval method ensures the best results for your experiments.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Transgelin/TAGLN/SM22 alpha Antibody - BSA Free

• DKFZp686P11128
• Protein WS3-10
• SM22 alpha
• SM2222 kDa actin-binding protein
• SMCCDKFZp686B01212
• Smooth muscle protein 22-alpha
• TAGLN
• TAGLN1
• transgelin variant 2
• Transgelin
• WS3-10
• WS3-10SM22-alpha

Background

In contrast to fast and slow skeletal muscle cells that fuse and terminally differentiate, smooth muscle cells are able to simultaneously proliferate and express lineage-restricted proteins. One of these proteins, expressed exclusively in smooth muscles, has been referred to as SM22-alpha, a 22 kDa protein with structural similarity to the vertebrate thin filament myofibrillar regulatory protein calponin and the Drosophila muscle protein mp20, neither of which play a direct role in the contractile apparatus.The protein is a transformation and shape-change sensitive actin cross-linking/geling protein found in fibroblasts and smooth muscle. Its expression is down-regulated in many cell lines, and this down-regulation may be an early and sensitive marker for the onset of transformation. A functional role of this protein is unclear.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TAGLN