Transgelin/TAGLN/SM22 alpha Antibody - BSA Free Summary
| Immunogen |
This antibody has been engineered to specifically recognize the recombinant protein Transgelin/TAGLN/SM22 alpha using the following amino acid sequence: KNDGHYRGDPNWFMKKAQEHKREFTESQLQ |
| Predicted Species |
Mouse (90%), Rat (97%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
TAGLN |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
- Western Blot 0.04-0.4 µg/ml
|
| Application Notes |
For IHC-Paraffin, we recommend using Heat-Induced Epitope Retrieval (HIER) with a pH level of 6. This optimized retrieval method ensures the best results for your experiments. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Transgelin/TAGLN/SM22 alpha Antibody - BSA Free
Background
In contrast to fast and slow skeletal muscle cells that fuse and terminally differentiate, smooth muscle cells are able to simultaneously proliferate and express lineage-restricted proteins. One of these proteins, expressed exclusively in smooth muscles, has been referred to as SM22-alpha, a 22 kDa protein with structural similarity to the vertebrate thin filament myofibrillar regulatory protein calponin and the Drosophila muscle protein mp20, neither of which play a direct role in the contractile apparatus.The protein is a transformation and shape-change sensitive actin cross-linking/geling protein found in fibroblasts and smooth muscle. Its expression is down-regulated in many cell lines, and this down-regulation may be an early and sensitive marker for the onset of transformation. A functional role of this protein is unclear.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC-P, IP, PA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu
Applications: IHC, Simple Western, WB
Species: Hu, Mu
Applications: CyTOF-ready, ICFlow, WB
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
Species: Hu, Mu
Applications: WB
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
Publications for Transgelin/TAGLN/SM22 alpha Antibody (NBP3-25205) (0)
There are no publications for Transgelin/TAGLN/SM22 alpha Antibody (NBP3-25205).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Transgelin/TAGLN/SM22 alpha Antibody (NBP3-25205) (0)
There are no reviews for Transgelin/TAGLN/SM22 alpha Antibody (NBP3-25205).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Transgelin/TAGLN/SM22 alpha Antibody (NBP3-25205) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Transgelin/TAGLN/SM22 alpha Products
Blogs on Transgelin/TAGLN/SM22 alpha