TRAM2 Antibody - BSA Free

Western Blot: TRAM2 Antibody [NBP2-88454] - Host: Rabbit. Target Name: TRAM2. Sample Tissue: Human Lung Tumor lysates. Antibody Dilution: 1ug/ml

Product Discontinued

TRAM2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TRAM2 Antibody - BSA Free (NBP2-88454) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human TRAM2. Peptide sequence: SQLRHWREYWNEQSAKRRVPATPRLPARLIKRESGYHENGVVKAENGTSP The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TRAM2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for TRAM2 Antibody - BSA Free

• KIAA0057TRAM-like protein
• translocating chain-associated membrane protein 2
• translocation associated membrane protein 2

Background

TRAM2 - translocation associated membrane protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TRAM2