TRAF-4 Recombinant Protein Antigen

Images

 
There are currently no images for TRAF-4 Protein (NBP2-33647PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TRAF-4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TRAF4.

Source: E.coli

Amino Acid Sequence: GAFDNLLEWPFARRVTFSLLDQSDPGLAKPQHVTETFHPDPNWKNFQKPGTWRGSLDESSLGFGYPKFISHQDIRKRNYVRDDAVFIRAAVELPRKI

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TRAF4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-33647.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for TRAF-4 Recombinant Protein Antigen

  • CART1
  • CART1RING finger protein 83
  • Cysteine-rich domain associated with RING and Traf domains protein 1
  • Metastatic lymph node gene 62 protein
  • MLN 62
  • MLN62
  • MLN62cysteine-rich domain associated with ring and TRAF domain
  • RNF83malignant 62
  • TNF receptor-associated factor 4
  • TRAF4
  • TRAF-4
  • tumor necrosis receptor-associated factor 4A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56170
Species: Hu, Bv, Ca
Applications: WB, IHC, IHC-P, IP
NBP2-26506
Species: Hu, Mu, Rt
NB100-56715
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56176
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NB100-56178
Species: Hu, Mu, Rt, Ge
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB100-56583
Species: Hu, Rb
Applications: WB, Flow, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-56144
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NB100-790
Species: Hu, Mu, Po
Applications: WB, IHC-P, PEP-ELISA
DDX0131P-100
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
MAB367
Species: Hu, Ca
Applications: WB, IHC, ICC
NBP1-88189
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
MAB1904
Species: Hu
Applications: WB, IHC, ICC
NBP2-33647PEP
Species: Hu
Applications: AC

Publications for TRAF-4 Protein (NBP2-33647PEP) (0)

There are no publications for TRAF-4 Protein (NBP2-33647PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRAF-4 Protein (NBP2-33647PEP) (0)

There are no reviews for TRAF-4 Protein (NBP2-33647PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for TRAF-4 Protein (NBP2-33647PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for TRAF-4 Protein (NBP2-33647PEP)

Discover related pathways, diseases and genes to TRAF-4 Protein (NBP2-33647PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRAF-4 Protein (NBP2-33647PEP)

Discover more about diseases related to TRAF-4 Protein (NBP2-33647PEP).
 

Pathways for TRAF-4 Protein (NBP2-33647PEP)

View related products by pathway.

PTMs for TRAF-4 Protein (NBP2-33647PEP)

Learn more about PTMs related to TRAF-4 Protein (NBP2-33647PEP).
 

Research Areas for TRAF-4 Protein (NBP2-33647PEP)

Find related products by research area.

Blogs on TRAF-4

There are no specific blogs for TRAF-4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

TRAF-4 Antibody
NB100-56177

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TRAF-4 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TRAF4