TRAF-3 Recombinant Protein Antigen

Images

 
There are currently no images for TRAF-3 Protein (NBP1-86639PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TRAF-3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TRAF3.

Source: E. coli

Amino Acid Sequence: SSSPKCTACQESIVKDKVFKDNCCKREILALQIYCRNESRGCAEQLTLGHLLVHLKNDCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIALQKHEDTDCPCVV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TRAF3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86639.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TRAF-3 Recombinant Protein Antigen

  • CAP1
  • CAP-1CD40 receptor associated factor 1
  • CD40 associated protein 1
  • CD40 binding protein
  • CD40 receptor-associated factor 1
  • CD40-binding protein
  • CD40bp
  • CRAF1
  • CRAF1CAP1
  • LAP1
  • LAP1CD40BP
  • LMP1-associated protein 1
  • TNF receptor-associated factor 3
  • TRAF3
  • TRAF-3

Background

Human TRAF-3 is a signaling molecule that interacts with the cytoplasmic tails of CD40 and other TNF-receptor family members (1). The TNF-receptor-associated factor (TRAF) family is a phylogenetically conserved group of scaffold proteins that link receptors of the IL-1R/Toll and TNF receptor family to signalling cascades, leading to the activation of NF-kappaB and mitogen-activated protein kinases. Furthermore, TRAF proteins serve as a docking platform for a variety of regulators of these signaling pathways and are themselves often regulated at the transcriptional and posttranslational level (2). The CD40 fragment binds as a hairpin loop across the surface of the TRAF domain. Residues shown by mutagenesis and deletion analysis to be critical for TRAF3 binding are involved either in direct contact with TRAF3 or in intramolecular interactions that stabilize the hairpin (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB3277
Species: Hu, Mu, Rt
Applications: ICC, KO, WB
NB100-56144
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB
AF632
Species: Hu
Applications: AgAct, Simple Western, WB
NBP2-26506
Species: Hu, Mu, Rt
Applications: B/N, In vitro
NB100-56170
Species: Bv, Ca, Hu
Applications: IHC,  IHC-P, IP, WB
NB100-56178
Species: Ma, Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, IP, WB
DCDL40
Species: Hu
Applications: ELISA
NBP1-84841
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-77275
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP2-23603
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-48284
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-58853
Species: Hu
Applications: IHC,  IHC-P, WB
AF6386
Species: Hu
Applications: IP, WB
NBP2-67741
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
AF1162
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut, WB
NBP1-87760
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, Simple Western, WB
NBP1-86639PEP
Species: Hu
Applications: AC

Publications for TRAF-3 Protein (NBP1-86639PEP) (0)

There are no publications for TRAF-3 Protein (NBP1-86639PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRAF-3 Protein (NBP1-86639PEP) (0)

There are no reviews for TRAF-3 Protein (NBP1-86639PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TRAF-3 Protein (NBP1-86639PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TRAF-3 Products

Research Areas for TRAF-3 Protein (NBP1-86639PEP)

Find related products by research area.

Blogs on TRAF-3

There are no specific blogs for TRAF-3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TRAF-3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TRAF3