Recombinant Human TRADD Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human TRADD Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 203-312 of Human TRADD partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:LFQGQPVVNRPLSLKDQQTFARSVGLKWRKVGRSLQRGCRALRDPALDSLAYEYEREGLYEQAFQLLRRFVQAEGRRATLQRLVEALEENELTSLAEDLLGLTDPNGGLA

Protein/Peptide Type
Partial Recombinant Protein
Gene
TRADD

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
20 mM Tris, pH 8.0, 1 mM DTT

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TRADD Protein

  • MGC11078
  • TNFRSF1A-associated via death domainTNFR1-associated DEATH domain protein
  • TRADD
  • tumor necrosis factor receptor type 1 associated death domain protein
  • tumor necrosis factor receptor type 1-associated DEATH domain protein
  • tumor necrosis factor receptor-1-associated protein

Background

TRADD - TNFRSF1A-associated via death domain

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56715
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-77077
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-81831
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NB100-56170
Species: Hu, Bv, Ca
Applications: WB, IHC, IHC-P, IP
NB100-56116
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-56144
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27203
Species: Hu, Mu, Rt, Po, Ch, ChHa, Eq, Fe, GP, Op, Other, Pm, Rb
Applications: WB, Flow
NBP1-81706
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP

Publications for TRADD Partial Recombinant Protein (H00008717-Q01) (0)

There are no publications for TRADD Partial Recombinant Protein (H00008717-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRADD Partial Recombinant Protein (H00008717-Q01) (0)

There are no reviews for TRADD Partial Recombinant Protein (H00008717-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TRADD Partial Recombinant Protein (H00008717-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TRADD Products

Bioinformatics Tool for TRADD Partial Recombinant Protein (H00008717-Q01)

Discover related pathways, diseases and genes to TRADD Partial Recombinant Protein (H00008717-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRADD Partial Recombinant Protein (H00008717-Q01)

Discover more about diseases related to TRADD Partial Recombinant Protein (H00008717-Q01).
 

Pathways for TRADD Partial Recombinant Protein (H00008717-Q01)

View related products by pathway.

PTMs for TRADD Partial Recombinant Protein (H00008717-Q01)

Learn more about PTMs related to TRADD Partial Recombinant Protein (H00008717-Q01).
 

Research Areas for TRADD Partial Recombinant Protein (H00008717-Q01)

Find related products by research area.

Blogs on TRADD.

Caspase 9: The Suicidal Cell Whisperer
Cell death via apoptosis is a key cellular function triggered by the cell death receptor family and their ligands which signal through downstream adaptor molecules and the caspase protease family. Among the subclass of initiator caspases that include...  Read full blog post.

Customers Who Bought This Also Bought

TRADD Antibody
NB100-56169

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TRADD Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TRADD
Entrez