TORC1 Recombinant Protein Antigen

Images

 
There are currently no images for TORC1 Protein (NBP1-89865PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TORC1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CRTC1.

Source: E. coli

Amino Acid Sequence: SPPADTSWRRTNSDSALHQSTMTPTQPESFSSGSQDVHQKRVLLLTVPGMEETTSEADKNLSKQAWDTKKTGSRPKSCEV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CRTC1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89865. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TORC1 Recombinant Protein Antigen

  • CREB regulated transcription coactivator 1
  • CRTC1
  • FLJ14027WAMTP1
  • KIAA0616Transducer of regulated cAMP response element-binding protein 1
  • MECT1
  • MECT1CREB-regulated transcription coactivator 1
  • mucoepidermoid carcinoma translocated 1
  • Mucoepidermoid carcinoma translocated protein 1
  • TORC1
  • TORC1TORC-1
  • Transducer of CREB protein 1
  • transducer of regulated cAMP response element-binding protein (CREB) 1
  • WAMTP1

Background

MECT1 (also known as MucoEpidermoid Carcinoma Translocated 1, Transducer of regulated cAMP response element-binding protein 1, TORC1, and Transducer of CREB protein 1) is a nuclear protein that functions as a transcriptional coactivator for CREB1, which activates transcription through both consensus and variant cAMP response element (CRE) sites. MECT1does not appear to modulate CREB1 DNA-binding activity but enhances the interaction of CREB1 with TAF4/TAFII-130. MECT1 translocates with MAML2 (MasterMind-Like Protein 2) to yield a fusion oncogene: t(11;19) (q21;p13). This translocation occurs in mucoepidermoid carcinomas, benign Warthin tumors and clear cell hidradenomas. The novel fusion product that results disrupts the Notch signaling pathway. The fusion protein consists of the N-terminus of MECT1 joined to the C-terminus of MAML2. The reciprocal fusion protein consisting of the N-terminus of MAML2 joined to the C-terminus of MECT1 has been detected in a small number of mucoepidermoid carcinomas. Multiple isoforms have been reported for the MECT1 protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-607
Species: Hu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP2-22356
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP2-24503
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
DYC2510-2
Species: Hu, Mu, Rt
Applications: ELISA
AF3918
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NBP2-67552
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP2-24837
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-46234
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-53228
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-19804
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-87799
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF8962
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NB100-611
Species: Hu
Applications: IP, WB
NBP2-15071
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
DBD00
Species: Hu
Applications: ELISA
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NB200-157
Species: Hu
Applications: IHC,  IHC-P, KO, WB

Publications for TORC1 Protein (NBP1-89865PEP) (0)

There are no publications for TORC1 Protein (NBP1-89865PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TORC1 Protein (NBP1-89865PEP) (0)

There are no reviews for TORC1 Protein (NBP1-89865PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TORC1 Protein (NBP1-89865PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TORC1 Products

Research Areas for TORC1 Protein (NBP1-89865PEP)

Find related products by research area.

Blogs on TORC1

There are no specific blogs for TORC1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TORC1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CRTC1