Topo III beta Recombinant Protein Antigen

Images

 
There are currently no images for Topo III beta Recombinant Protein Antigen (NBP3-17775PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Topo III beta Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Topo III beta

Source: E. coli

Amino Acid Sequence: TIKLYKELRCPLDDFELVLWSSGSRGKSYPLCPYCYNHPPFRDMKKGMGCNECTHPSCQHSLSMLGIGQCVECESGVLVLDPTSGPKWKVACNKCNVV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TOP3B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17775.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Topo III beta Recombinant Protein Antigen

  • DNA topoisomerase 3-beta-1
  • DNA topoisomerase III beta-1
  • EC 5.99.1.2
  • FLJ39376
  • TOP3B1
  • topoisomerase (DNA) III beta
  • topoisomerase III beta

Background

Topo III beta encodes a DNA topoisomerase, an enzyme that controls and alters the topologic states of DNA during transcription. This enzyme catalyzes the transient breaking and rejoining of a single strand of DNA which allows the strands to pass through one another, thus relaxing the supercoils and altering the topology of DNA. The enzyme interacts with DNA helicase SGS1 and plays a role in DNA recombination, cellular aging and maintenance of genome stability. Alternative splicing of the C-terminus of this gene results in three transcript variants which have distinct tissue specificity; however, not all variants have been fully described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DY453
Species: Mu
Applications: ELISA
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, PLA, S-ELISA, Simple Western, WB
AF4984
Species: Hu
Applications: ChIP, CyTOF-ready, ICC, ICFlow, Simple Western, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-52983
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
AF942
Species: Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow, WB
NBP2-21601
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-45780
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-32252
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-01020
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
H00152503-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
H00007520-M02
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, QFN, S-ELISA, WB
NBP2-07650
Species: Hu
Applications: WB
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NB100-353
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, IP, WB
AF1819
Species: Mu
Applications: ELISA, IHC, WB
NBP1-32002
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NB100-464
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
NBP3-17775PEP
Species: Hu
Applications: AC

Publications for Topo III beta Recombinant Protein Antigen (NBP3-17775PEP) (0)

There are no publications for Topo III beta Recombinant Protein Antigen (NBP3-17775PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Topo III beta Recombinant Protein Antigen (NBP3-17775PEP) (0)

There are no reviews for Topo III beta Recombinant Protein Antigen (NBP3-17775PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Topo III beta Recombinant Protein Antigen (NBP3-17775PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Topo III beta Products

Research Areas for Topo III beta Recombinant Protein Antigen (NBP3-17775PEP)

Find related products by research area.

Blogs on Topo III beta

There are no specific blogs for Topo III beta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Topo III beta Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TOP3B